Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   BSA41_RS13180 Genome accession   NZ_CP015610
Coordinates   2486663..2486803 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus safensis strain U41     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2481663..2491803
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSA41_RS13155 (BSA41_12870) - 2481928..2482317 (-) 390 WP_041088470.1 hotdog fold thioesterase -
  BSA41_RS13160 (BSA41_12875) comA 2482341..2482982 (-) 642 WP_024423322.1 response regulator transcription factor Regulator
  BSA41_RS13165 (BSA41_12880) comP 2483063..2485375 (-) 2313 WP_075611853.1 ATP-binding protein Regulator
  BSA41_RS13170 comX 2485430..2485600 (-) 171 WP_075611854.1 competence pheromone ComX -
  BSA41_RS13175 (BSA41_12885) - 2485597..2486511 (-) 915 WP_075611855.1 polyprenyl synthetase family protein -
  BSA41_RS13180 (BSA41_12890) degQ 2486663..2486803 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  BSA41_RS13185 (BSA41_12895) - 2487309..2487665 (+) 357 WP_041088463.1 hypothetical protein -
  BSA41_RS13190 (BSA41_12900) - 2487701..2488927 (-) 1227 WP_075611856.1 EAL and HDOD domain-containing protein -
  BSA41_RS13195 (BSA41_12905) - 2489065..2490477 (-) 1413 WP_229137108.1 nicotinate phosphoribosyltransferase -
  BSA41_RS13200 (BSA41_12910) - 2490555..2491106 (-) 552 WP_024425949.1 cysteine hydrolase family protein -
  BSA41_RS13205 (BSA41_12915) - 2491166..2491573 (-) 408 WP_041088459.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=181399 BSA41_RS13180 WP_003213123.1 2486663..2486803(-) (degQ) [Bacillus safensis strain U41]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=181399 BSA41_RS13180 WP_003213123.1 2486663..2486803(-) (degQ) [Bacillus safensis strain U41]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATCAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment