Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | A2I63_RS10175 | Genome accession | NZ_CP015536 |
| Coordinates | 2084749..2085180 (-) | Length | 143 a.a. |
| NCBI ID | WP_015899733.1 | Uniprot ID | B9DJE5 |
| Organism | Staphylococcus carnosus strain TMW 2.243 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2047525..2093757 | 2084749..2085180 | within | 0 |
Gene organization within MGE regions
Location: 2047525..2093757
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A2I63_RS09920 (A2I63_09780) | - | 2047525..2048325 (-) | 801 | WP_015899779.1 | glycerophosphodiester phosphodiesterase family protein | - |
| A2I63_RS09925 | - | 2048405..2048545 (-) | 141 | WP_015899778.1 | hypothetical protein | - |
| A2I63_RS09930 (A2I63_09785) | - | 2048538..2049218 (-) | 681 | WP_015899777.1 | hypothetical protein | - |
| A2I63_RS09935 (A2I63_09795) | - | 2049912..2051315 (-) | 1404 | WP_015899776.1 | N-acetylmuramoyl-L-alanine amidase | - |
| A2I63_RS09940 (A2I63_09800) | - | 2051315..2051578 (-) | 264 | WP_015899775.1 | phage holin | - |
| A2I63_RS09945 (A2I63_09805) | - | 2051637..2053742 (-) | 2106 | WP_015899774.1 | BppU family phage baseplate upper protein | - |
| A2I63_RS09950 (A2I63_09810) | - | 2053789..2054187 (-) | 399 | WP_015899773.1 | hypothetical protein | - |
| A2I63_RS09955 (A2I63_09815) | - | 2054174..2054596 (-) | 423 | WP_015899772.1 | hypothetical protein | - |
| A2I63_RS09960 | - | 2054635..2054808 (-) | 174 | WP_015899771.1 | XkdX family protein | - |
| A2I63_RS09965 (A2I63_09820) | - | 2054808..2055164 (-) | 357 | WP_015899770.1 | hypothetical protein | - |
| A2I63_RS09970 (A2I63_09825) | - | 2055169..2056593 (-) | 1425 | WP_015899769.1 | BppU family phage baseplate upper protein | - |
| A2I63_RS09975 (A2I63_09830) | - | 2056596..2058551 (-) | 1956 | WP_015899768.1 | glycosyl hydrolase family 28-related protein | - |
| A2I63_RS09980 (A2I63_09835) | - | 2058556..2058774 (-) | 219 | WP_015899767.1 | hypothetical protein | - |
| A2I63_RS09985 (A2I63_09840) | - | 2058778..2060331 (-) | 1554 | WP_253724525.1 | prophage endopeptidase tail family protein | - |
| A2I63_RS09990 (A2I63_09845) | - | 2060342..2061175 (-) | 834 | WP_015899765.1 | phage tail domain-containing protein | - |
| A2I63_RS09995 (A2I63_09850) | - | 2061172..2063454 (-) | 2283 | WP_253724526.1 | peptidoglycan DD-metalloendopeptidase family protein | - |
| A2I63_RS10000 (A2I63_09855) | - | 2063435..2065381 (-) | 1947 | WP_253724527.1 | hypothetical protein | - |
| A2I63_RS10005 (A2I63_09860) | - | 2065329..2067434 (-) | 2106 | WP_015899763.1 | phage tail tape measure protein | - |
| A2I63_RS10010 | - | 2067448..2067603 (-) | 156 | WP_015899762.1 | hypothetical protein | - |
| A2I63_RS10015 (A2I63_09865) | - | 2067654..2067998 (-) | 345 | WP_015899761.1 | hypothetical protein | - |
| A2I63_RS10020 (A2I63_09870) | - | 2068046..2068507 (-) | 462 | WP_015899760.1 | Ig-like domain-containing protein | - |
| A2I63_RS10025 (A2I63_09875) | - | 2068584..2069225 (-) | 642 | WP_015899759.1 | major tail protein | - |
| A2I63_RS10030 (A2I63_09880) | - | 2069267..2069662 (-) | 396 | WP_015899758.1 | hypothetical protein | - |
| A2I63_RS10035 (A2I63_09885) | - | 2069659..2070066 (-) | 408 | WP_015899757.1 | hypothetical protein | - |
| A2I63_RS10040 (A2I63_09890) | - | 2070063..2070419 (-) | 357 | WP_231839067.1 | hypothetical protein | - |
| A2I63_RS10045 (A2I63_09895) | - | 2070403..2070699 (-) | 297 | WP_015899755.1 | hypothetical protein | - |
| A2I63_RS10050 (A2I63_09900) | - | 2070772..2071890 (-) | 1119 | WP_015899754.1 | phage major capsid protein | - |
| A2I63_RS10055 (A2I63_09905) | - | 2071915..2072631 (-) | 717 | WP_015899753.1 | head maturation protease, ClpP-related | - |
| A2I63_RS10060 (A2I63_09910) | - | 2072621..2073793 (-) | 1173 | WP_015899752.1 | phage portal protein | - |
| A2I63_RS10065 (A2I63_09915) | - | 2073808..2075448 (-) | 1641 | WP_015899751.1 | terminase large subunit | - |
| A2I63_RS10070 (A2I63_09920) | - | 2075445..2075792 (-) | 348 | WP_015899750.1 | hypothetical protein | - |
| A2I63_RS10075 (A2I63_09925) | - | 2075969..2076301 (-) | 333 | WP_041612952.1 | HNH endonuclease | - |
| A2I63_RS10080 (A2I63_09930) | - | 2076596..2077009 (-) | 414 | WP_015899749.1 | hypothetical protein | - |
| A2I63_RS10085 (A2I63_09935) | - | 2077022..2077201 (-) | 180 | WP_015899748.1 | hypothetical protein | - |
| A2I63_RS10090 | - | 2077335..2077721 (-) | 387 | WP_041612951.1 | hypothetical protein | - |
| A2I63_RS10095 (A2I63_09945) | - | 2077725..2078009 (-) | 285 | WP_015899747.1 | hypothetical protein | - |
| A2I63_RS10100 (A2I63_09950) | - | 2078002..2078274 (-) | 273 | WP_041612950.1 | hypothetical protein | - |
| A2I63_RS10105 | - | 2078416..2078523 (-) | 108 | Protein_1965 | DUF1381 domain-containing protein | - |
| A2I63_RS10110 (A2I63_09960) | - | 2078524..2078730 (-) | 207 | WP_015899745.1 | hypothetical protein | - |
| A2I63_RS10115 (A2I63_09965) | - | 2078780..2079289 (-) | 510 | WP_015899744.1 | dUTP pyrophosphatase | - |
| A2I63_RS10120 (A2I63_09970) | - | 2079290..2079493 (-) | 204 | WP_041612949.1 | hypothetical protein | - |
| A2I63_RS10125 (A2I63_09975) | - | 2079486..2079683 (-) | 198 | WP_015899743.1 | hypothetical protein | - |
| A2I63_RS10130 (A2I63_09980) | - | 2079730..2080215 (-) | 486 | WP_015899742.1 | nucleoside 2-deoxyribosyltransferase | - |
| A2I63_RS10135 (A2I63_09985) | - | 2080208..2080684 (-) | 477 | WP_015899741.1 | DUF3310 domain-containing protein | - |
| A2I63_RS10140 (A2I63_09990) | - | 2080685..2081215 (-) | 531 | WP_015899740.1 | hypothetical protein | - |
| A2I63_RS10145 | - | 2081221..2081397 (-) | 177 | WP_015899739.1 | hypothetical protein | - |
| A2I63_RS10150 (A2I63_09995) | - | 2081394..2081801 (-) | 408 | WP_015899738.1 | RusA family crossover junction endodeoxyribonuclease | - |
| A2I63_RS10155 (A2I63_10005) | - | 2081967..2082752 (-) | 786 | WP_015899737.1 | ATP-binding protein | - |
| A2I63_RS10160 (A2I63_10010) | - | 2082753..2083514 (-) | 762 | WP_015899736.1 | conserved phage C-terminal domain-containing protein | - |
| A2I63_RS10165 (A2I63_10015) | - | 2083511..2084185 (-) | 675 | WP_015899735.1 | putative HNHc nuclease | - |
| A2I63_RS10170 (A2I63_10020) | - | 2084186..2084737 (-) | 552 | WP_015899734.1 | NUMOD4 domain-containing protein | - |
| A2I63_RS10175 (A2I63_10025) | ssbA | 2084749..2085180 (-) | 432 | WP_015899733.1 | single-stranded DNA-binding protein | Machinery gene |
| A2I63_RS10180 (A2I63_10030) | - | 2085180..2085851 (-) | 672 | WP_015899732.1 | ERF family protein | - |
| A2I63_RS10185 (A2I63_10035) | - | 2085808..2086068 (-) | 261 | WP_015899731.1 | DUF2483 family protein | - |
| A2I63_RS10190 (A2I63_10040) | - | 2086061..2086306 (-) | 246 | WP_015899730.1 | hypothetical protein | - |
| A2I63_RS10195 (A2I63_10045) | - | 2086394..2086615 (-) | 222 | WP_041612947.1 | hypothetical protein | - |
| A2I63_RS10200 (A2I63_10050) | - | 2086612..2086848 (-) | 237 | WP_015899729.1 | hypothetical protein | - |
| A2I63_RS10205 (A2I63_10055) | - | 2086912..2087184 (+) | 273 | WP_015899728.1 | hypothetical protein | - |
| A2I63_RS10210 | - | 2087162..2087311 (-) | 150 | WP_167313206.1 | hypothetical protein | - |
| A2I63_RS10215 (A2I63_10065) | - | 2087855..2088079 (+) | 225 | WP_015899727.1 | hypothetical protein | - |
| A2I63_RS10220 | - | 2088072..2088218 (-) | 147 | WP_165380129.1 | hypothetical protein | - |
| A2I63_RS10225 (A2I63_10070) | - | 2088233..2089000 (-) | 768 | WP_015899725.1 | phage antirepressor | - |
| A2I63_RS10230 (A2I63_10075) | - | 2089037..2089264 (-) | 228 | WP_050731401.1 | helix-turn-helix transcriptional regulator | - |
| A2I63_RS10235 (A2I63_10080) | - | 2089439..2089762 (+) | 324 | WP_015899724.1 | helix-turn-helix transcriptional regulator | - |
| A2I63_RS10240 (A2I63_10085) | - | 2089778..2090242 (+) | 465 | WP_015899723.1 | ImmA/IrrE family metallo-endopeptidase | - |
| A2I63_RS10245 (A2I63_10090) | - | 2090584..2090766 (+) | 183 | WP_015899722.1 | hypothetical protein | - |
| A2I63_RS10250 (A2I63_10095) | - | 2091243..2092292 (+) | 1050 | WP_015899721.1 | tyrosine-type recombinase/integrase | - |
| A2I63_RS10255 (A2I63_10100) | sufB | 2092360..2093757 (-) | 1398 | WP_015899720.1 | Fe-S cluster assembly protein SufB | - |
Sequence
Protein
Download Length: 143 a.a. Molecular weight: 15877.49 Da Isoelectric Point: 5.2069
>NTDB_id=180545 A2I63_RS10175 WP_015899733.1 2084749..2085180(-) (ssbA) [Staphylococcus carnosus strain TMW 2.243]
MINRVVLVGRLTKDPEFRTTPSGVDVATFTLAVNRNFKSKNGEQQADFINCVVFRKQAENVNNYLNKGSLAGVDGRLQSR
SYENKEGQRVFVTEVVADSVQFLEPKNNNQQNNQPQQQQGQAPAGNNPFGNASDDISESELPF
MINRVVLVGRLTKDPEFRTTPSGVDVATFTLAVNRNFKSKNGEQQADFINCVVFRKQAENVNNYLNKGSLAGVDGRLQSR
SYENKEGQRVFVTEVVADSVQFLEPKNNNQQNNQPQQQQGQAPAGNNPFGNASDDISESELPF
Nucleotide
Download Length: 432 bp
>NTDB_id=180545 A2I63_RS10175 WP_015899733.1 2084749..2085180(-) (ssbA) [Staphylococcus carnosus strain TMW 2.243]
ATGATTAACAGAGTCGTATTAGTAGGTCGTTTAACAAAAGATCCAGAATTCAGAACAACCCCGAGCGGTGTAGATGTAGC
AACATTCACACTAGCAGTCAACCGTAATTTTAAGAGTAAAAATGGAGAGCAACAGGCGGACTTTATCAACTGTGTTGTAT
TCCGTAAACAAGCAGAAAACGTCAATAATTATTTGAATAAAGGCAGTTTAGCAGGTGTCGATGGTCGCTTACAATCACGC
AGCTATGAAAATAAGGAAGGACAACGTGTGTTTGTAACCGAAGTAGTAGCAGATAGTGTTCAATTCTTAGAGCCAAAGAA
TAACAATCAACAAAACAATCAACCTCAACAACAACAAGGGCAAGCACCAGCAGGCAATAACCCGTTTGGAAATGCTAGCG
ACGATATTTCAGAATCGGAACTCCCTTTCTAG
ATGATTAACAGAGTCGTATTAGTAGGTCGTTTAACAAAAGATCCAGAATTCAGAACAACCCCGAGCGGTGTAGATGTAGC
AACATTCACACTAGCAGTCAACCGTAATTTTAAGAGTAAAAATGGAGAGCAACAGGCGGACTTTATCAACTGTGTTGTAT
TCCGTAAACAAGCAGAAAACGTCAATAATTATTTGAATAAAGGCAGTTTAGCAGGTGTCGATGGTCGCTTACAATCACGC
AGCTATGAAAATAAGGAAGGACAACGTGTGTTTGTAACCGAAGTAGTAGCAGATAGTGTTCAATTCTTAGAGCCAAAGAA
TAACAATCAACAAAACAATCAACCTCAACAACAACAAGGGCAAGCACCAGCAGGCAATAACCCGTTTGGAAATGCTAGCG
ACGATATTTCAGAATCGGAACTCCCTTTCTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
56.977 |
100 |
0.685 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
52.353 |
100 |
0.622 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
60.377 |
74.126 |
0.448 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
43.75 |
100 |
0.441 |
| ssbA | Streptococcus mutans UA159 |
43.056 |
100 |
0.434 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
41.259 |
100 |
0.413 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
41.259 |
100 |
0.413 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
40.559 |
100 |
0.406 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
40.559 |
100 |
0.406 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
40.559 |
100 |
0.406 |
| ssbB/cilA | Streptococcus mitis SK321 |
40.559 |
100 |
0.406 |