Detailed information NTG0179925

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: A6V38_RS08210
• Genome accession: NZ_CP015447
• Coordinates: 1627081..1627392 (-)
• Length: 103 a.a.
• NCBI ID: WP_000472256.1
• Uniprot ID: -
• Organism: Staphylococcus aureus strain M92
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1622081..1632392

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
A6V38_RS08175 (A6V38_08200)	gcvPA	1622583..1623929 (-)	1347	WP_000019687.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
A6V38_RS08180 (A6V38_08205)	gcvT	1623949..1625040 (-)	1092	WP_000093351.1	glycine cleavage system aminomethyltransferase GcvT	-
A6V38_RS08185 (A6V38_08210)	-	1625199..1625723 (-)	525	WP_001015117.1	shikimate kinase	-
A6V38_RS08190 (A6V38_08215)	-	1625713..1625859 (-)	147	WP_001789879.1	hypothetical protein	-
A6V38_RS08195 (A6V38_08220)	comGF	1625956..1626453 (-)	498	WP_001803317.1	competence type IV pilus minor pilin ComGF	Machinery gene
A6V38_RS08200 (A6V38_08225)	comGE	1626371..1626670 (-)	300	WP_000844413.1	hypothetical protein	Machinery gene
A6V38_RS08205 (A6V38_08230)	comGD	1626657..1627103 (-)	447	WP_001790850.1	competence type IV pilus minor pilin ComGD	Machinery gene
A6V38_RS08210 (A6V38_08235)	comGC	1627081..1627392 (-)	312	WP_000472256.1	competence type IV pilus major pilin ComGC	Machinery gene
A6V38_RS08215 (A6V38_08240)	comGB	1627406..1628476 (-)	1071	WP_000775706.1	competence type IV pilus assembly protein ComGB	Machinery gene
A6V38_RS08220 (A6V38_08245)	comGA	1628448..1629422 (-)	975	WP_000697228.1	competence type IV pilus ATPase ComGA	Machinery gene
A6V38_RS08225 (A6V38_08250)	-	1629474..1630097 (-)	624	WP_001223008.1	MBL fold metallo-hydrolase	-
A6V38_RS08230 (A6V38_08255)	-	1630094..1630423 (-)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
A6V38_RS08235 (A6V38_08260)	-	1630423..1631409 (-)	987	WP_061843225.1	ROK family glucokinase	-
A6V38_RS08240 (A6V38_08265)	-	1631406..1631609 (-)	204	WP_000087561.1	YqgQ family protein	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11315.36 Da
• Isoelectric Point: 8.5268

>NTDB_id=179925 A6V38_RS08210 WP_000472256.1 1627081..1627392(-) (comGC) [Staphylococcus aureus strain M92]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=179925 A6V38_RS08210 WP_000472256.1 1627081..1627392(-) (comGC) [Staphylococcus aureus strain M92]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	100	100	1
comGC	Staphylococcus aureus N315	100	100	1
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae Rx1	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae D39	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae R6	46.078	99.029	0.456
comGC/cglC	Streptococcus mitis SK321	51.163	83.495	0.427
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comYC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369