Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   A1D33_RS13875 Genome accession   NZ_CP015443
Coordinates   2970183..2970323 (+) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain CC09     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2965183..2975323
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  A1D33_RS13850 (A1D33_013850) - 2965489..2965887 (+) 399 WP_003152031.1 YueI family protein -
  A1D33_RS13855 (A1D33_013855) - 2965984..2966535 (+) 552 WP_003152033.1 cysteine hydrolase family protein -
  A1D33_RS13860 (A1D33_013860) - 2966553..2968019 (+) 1467 WP_015418109.1 nicotinate phosphoribosyltransferase -
  A1D33_RS13865 (A1D33_013865) - 2968149..2969372 (+) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  A1D33_RS13870 (A1D33_013870) - 2969379..2969720 (-) 342 WP_015418107.1 hypothetical protein -
  A1D33_RS13875 (A1D33_013875) degQ 2970183..2970323 (+) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  A1D33_RS13880 (A1D33_013880) comQ 2970454..2971440 (+) 987 WP_269195024.1 class 1 isoprenoid biosynthesis enzyme Regulator
  A1D33_RS13890 (A1D33_013890) comP 2971593..2973896 (+) 2304 WP_040238945.1 sensor histidine kinase Regulator
  A1D33_RS13895 (A1D33_013895) comA 2973977..2974621 (+) 645 WP_003152052.1 response regulator transcription factor Regulator
  A1D33_RS13900 (A1D33_013900) - 2974643..2975026 (+) 384 WP_040238946.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=179862 A1D33_RS13875 WP_003152043.1 2970183..2970323(+) (degQ) [Bacillus velezensis strain CC09]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=179862 A1D33_RS13875 WP_003152043.1 2970183..2970323(+) (degQ) [Bacillus velezensis strain CC09]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment