Detailed information    

insolico Bioinformatically predicted

Overview

Name   nucA/comI   Type   Machinery gene
Locus tag   AOU00_RS01120 Genome accession   NZ_CP015423
Coordinates   243500..243928 (-) Length   142 a.a.
NCBI ID   WP_069289694.1    Uniprot ID   -
Organism   Paenibacillus polymyxa strain J     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 232636..255671 243500..243928 within 0


Gene organization within MGE regions


Location: 232636..255671
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AOU00_RS01045 (AOU00_01040) - 232636..233322 (-) 687 WP_420488435.1 BclA C-terminal domain-containing protein -
  AOU00_RS01050 (AOU00_01045) - 233639..234073 (+) 435 WP_061832033.1 hypothetical protein -
  AOU00_RS01055 (AOU00_01050) - 234192..234413 (+) 222 WP_043882525.1 DUF6199 family natural product biosynthesis protein -
  AOU00_RS01065 (AOU00_01060) - 235616..235828 (+) 213 WP_069289685.1 helix-turn-helix domain-containing protein -
  AOU00_RS01070 (AOU00_01065) - 236069..236464 (-) 396 WP_069289686.1 LytTR family transcriptional regulator DNA-binding domain-containing protein -
  AOU00_RS25555 - 236479..236625 (-) 147 WP_075154285.1 cyclic lactone autoinducer peptide -
  AOU00_RS01075 (AOU00_01070) - 236603..237157 (-) 555 WP_069289687.1 accessory gene regulator ArgB-like protein -
  AOU00_RS01080 (AOU00_01075) - 237135..237767 (-) 633 WP_069289688.1 hypothetical protein -
  AOU00_RS01085 (AOU00_01080) - 237892..238224 (-) 333 WP_069289689.1 YolD-like family protein -
  AOU00_RS26885 - 238386..239276 (+) 891 WP_237166254.1 hypothetical protein -
  AOU00_RS27655 - 239492..239575 (-) 84 WP_223822117.1 putative holin-like toxin -
  AOU00_RS01095 (AOU00_01090) - 239718..239987 (-) 270 WP_069289690.1 CPCC family cysteine-rich protein -
  AOU00_RS26480 (AOU00_01100) - 240485..240868 (-) 384 WP_069291988.1 hypothetical protein -
  AOU00_RS01110 (AOU00_01105) - 240883..242025 (-) 1143 WP_069289692.1 hypothetical protein -
  AOU00_RS01115 (AOU00_01110) - 242279..243325 (-) 1047 WP_069289693.1 fibronectin type III domain-containing protein -
  AOU00_RS01120 (AOU00_01115) nucA/comI 243500..243928 (-) 429 WP_069289694.1 NucA/NucB deoxyribonuclease domain-containing protein Machinery gene
  AOU00_RS26890 (AOU00_01120) - 244165..244953 (+) 789 WP_069289695.1 hypothetical protein -
  AOU00_RS01130 (AOU00_01125) - 244978..245211 (-) 234 WP_069289696.1 hypothetical protein -
  AOU00_RS01135 (AOU00_01130) - 245400..246815 (-) 1416 WP_069289697.1 helix-turn-helix transcriptional regulator -
  AOU00_RS01140 (AOU00_01135) - 247059..247517 (+) 459 WP_069289698.1 hypothetical protein -
  AOU00_RS01145 (AOU00_01140) - 247543..247779 (+) 237 WP_069289699.1 hypothetical protein -
  AOU00_RS01150 (AOU00_01145) - 248239..248580 (-) 342 WP_069289700.1 phage holin -
  AOU00_RS01155 (AOU00_01150) - 248583..249413 (-) 831 WP_081330664.1 glycoside hydrolase family 25 protein -
  AOU00_RS01160 (AOU00_01155) - 249391..249894 (-) 504 WP_069289701.1 phage holin family protein -
  AOU00_RS01165 (AOU00_01160) - 249869..250069 (-) 201 WP_237166255.1 hypothetical protein -
  AOU00_RS25565 - 250131..250844 (-) 714 WP_081330665.1 phage antirepressor KilAC domain-containing protein -
  AOU00_RS01175 (AOU00_01170) - 251292..252383 (+) 1092 WP_172828246.1 tyrosinase family protein -
  AOU00_RS01180 (AOU00_01175) - 253144..253788 (-) 645 WP_069289703.1 Bro-N domain-containing protein -
  AOU00_RS01185 (AOU00_01180) - 253987..254193 (-) 207 WP_069289704.1 helix-turn-helix transcriptional regulator -
  AOU00_RS01190 (AOU00_01185) - 254292..254858 (+) 567 WP_069289705.1 helix-turn-helix domain-containing protein -
  AOU00_RS01195 (AOU00_01190) - 255075..255671 (-) 597 WP_069289706.1 2,' 3'-cyclic nucleotide 2'-phosphodiesterase -

Sequence

Protein


Download         Length: 142 a.a.        Molecular weight: 15326.36 Da        Isoelectric Point: 7.2405

>NTDB_id=179379 AOU00_RS01120 WP_069289694.1 243500..243928(-) (nucA/comI) [Paenibacillus polymyxa strain J]
MIKGIAKGLIVFLLAAIFSVQGVYAEPAVISQQAVAGYTLEFPSSRYPETGGHIRDAIAAGHSAVCTIDRDGAEENRKES
LKGYPTKKGYDRDEWPMAMCAEGGAGADIRYITPSDNRGAGSWVSHQLDKYADGTKVRFIVK

Nucleotide


Download         Length: 429 bp        

>NTDB_id=179379 AOU00_RS01120 WP_069289694.1 243500..243928(-) (nucA/comI) [Paenibacillus polymyxa strain J]
ATGATAAAAGGAATCGCAAAAGGATTAATCGTATTTTTGTTGGCAGCTATTTTTTCTGTTCAAGGTGTTTATGCTGAACC
GGCAGTAATCAGTCAACAAGCAGTAGCTGGGTATACGTTGGAGTTTCCAAGTTCACGCTACCCTGAAACAGGGGGACATA
TTAGAGATGCCATTGCAGCCGGACATTCCGCAGTATGCACGATTGACAGGGATGGAGCCGAGGAAAATAGGAAGGAGTCG
CTCAAGGGCTATCCGACGAAAAAAGGATATGACCGCGATGAATGGCCGATGGCAATGTGTGCAGAAGGCGGTGCAGGTGC
TGATATCCGATACATAACGCCTAGTGATAACCGGGGAGCAGGATCATGGGTAAGTCATCAGTTAGATAAATATGCAGACG
GAACTAAGGTAAGATTCATAGTGAAATAA

Domains

Predicted by InterproScan.

Deoxyribonuclease NucA/NucB (DNase_NucA_NucB)

(45-138)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

66.964

78.873

0.528

Multiple sequence alignment