Detailed information    

insolico Bioinformatically predicted

Overview

Name   comZ   Type   Regulator
Locus tag   AS891_RS17935 Genome accession   NZ_CP015375
Coordinates   3400058..3400249 (-) Length   63 a.a.
NCBI ID   WP_003224559.1    Uniprot ID   G4NWD2
Organism   Bacillus subtilis subsp. subtilis strain KCTC 3135     
Function   repression of comG operon (predicted from homology)   
Competence regulation

Genomic Context

Location: 3395058..3405249
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AS891_RS17910 (AS891_17905) appD 3395383..3396369 (-) 987 WP_003232965.1 oligopeptide ABC transporter ATP-binding protein AppD -
  AS891_RS17915 (AS891_17910) yjaZ 3396561..3397346 (-) 786 WP_003232967.1 DUF2268 domain-containing protein -
  AS891_RS17920 (AS891_17915) fabF 3397422..3398663 (-) 1242 WP_003244890.1 beta-ketoacyl-ACP synthase II -
  AS891_RS17925 (AS891_17920) fabH 3398686..3399624 (-) 939 WP_003232971.1 beta-ketoacyl-ACP synthase III -
  AS891_RS17930 (AS891_17925) yjzB 3399789..3400028 (+) 240 WP_003232972.1 spore coat protein YjzB -
  AS891_RS17935 (AS891_17930) comZ 3400058..3400249 (-) 192 WP_003224559.1 ComG operon transcriptional repressor ComZ Regulator
  AS891_RS17940 (AS891_17935) med 3400264..3401217 (-) 954 WP_003245494.1 transcriptional regulator Med Regulator
  AS891_RS17945 (AS891_17940) - 3401308..3401865 (-) 558 WP_003232974.1 hypothetical protein -
  AS891_RS17950 (AS891_17945) - 3401947..3402681 (-) 735 WP_003245223.1 hypothetical protein -
  AS891_RS17955 (AS891_17950) yjzD 3402930..3403115 (+) 186 WP_003245236.1 YjzD family protein -
  AS891_RS17960 (AS891_17955) yjzC 3403161..3403340 (-) 180 WP_003245356.1 YjzC family protein -
  AS891_RS17965 (AS891_17960) argF 3403426..3404385 (-) 960 WP_003232980.1 ornithine carbamoyltransferase -

Sequence

Protein


Download         Length: 63 a.a.        Molecular weight: 7214.27 Da        Isoelectric Point: 4.2564

>NTDB_id=178939 AS891_RS17935 WP_003224559.1 3400058..3400249(-) (comZ) [Bacillus subtilis subsp. subtilis strain KCTC 3135]
MQHEKSLEFLQIAMKYLPEAKEQLEKSGIELSMEAIQPFMNLFTTVMAEAYELGKSDAKSETE

Nucleotide


Download         Length: 192 bp        

>NTDB_id=178939 AS891_RS17935 WP_003224559.1 3400058..3400249(-) (comZ) [Bacillus subtilis subsp. subtilis strain KCTC 3135]
ATGCAGCACGAAAAATCACTTGAATTCTTGCAAATTGCCATGAAATATCTCCCTGAAGCGAAAGAACAGCTTGAGAAATC
AGGCATTGAGCTCTCAATGGAGGCCATCCAGCCGTTTATGAATCTATTTACAACGGTAATGGCGGAAGCTTATGAGCTTG
GCAAGTCTGACGCTAAATCTGAAACAGAATAA

Domains

Predicted by InterproScan.

ComZ (ComZ)

(4-58)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4NWD2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comZ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment