Detailed information
Overview
| Name | nucA/comI | Type | Machinery gene |
| Locus tag | AS891_RS10210 | Genome accession | NZ_CP015375 |
| Coordinates | 1959341..1959751 (+) | Length | 136 a.a. |
| NCBI ID | WP_009967785.1 | Uniprot ID | A0A6I4D881 |
| Organism | Bacillus subtilis subsp. subtilis strain KCTC 3135 | ||
| Function | cleavage of dsDNA into ssDNA (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1912895..1974595 | 1959341..1959751 | within | 0 |
Gene organization within MGE regions
Location: 1912895..1974595
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AS891_RS09890 (AS891_09885) | sknR | 1912895..1913245 (-) | 351 | WP_004398704.1 | transcriptional regulator SknR | - |
| AS891_RS09895 (AS891_09890) | yqaF | 1913422..1913652 (+) | 231 | WP_004398958.1 | helix-turn-helix transcriptional regulator | - |
| AS891_RS09900 (AS891_09895) | - | 1913682..1913822 (+) | 141 | WP_003229902.1 | hypothetical protein | - |
| AS891_RS09905 (AS891_09900) | yqaG | 1913896..1914465 (+) | 570 | WP_004398626.1 | helix-turn-helix domain-containing protein | - |
| AS891_RS09910 (AS891_09905) | sknH | 1914462..1914719 (+) | 258 | WP_003245994.1 | YqaH family protein | - |
| AS891_RS22875 | - | 1914716..1914889 (+) | 174 | WP_119123069.1 | hypothetical protein | - |
| AS891_RS09915 (AS891_09910) | yqaI | 1914849..1915043 (+) | 195 | WP_003229905.1 | YqaI family protein | - |
| AS891_RS09920 (AS891_09915) | yqaJ | 1915149..1916108 (+) | 960 | WP_004398673.1 | YqaJ viral recombinase family protein | - |
| AS891_RS09925 (AS891_09920) | recT | 1916111..1916965 (+) | 855 | WP_003229907.1 | recombinase RecT | - |
| AS891_RS09930 (AS891_09925) | yqaL | 1917041..1917718 (+) | 678 | WP_010886575.1 | DnaD domain-containing protein | - |
| AS891_RS09935 (AS891_09930) | sknM | 1917600..1918541 (+) | 942 | WP_075058863.1 | ATP-binding protein | - |
| AS891_RS09940 (AS891_09935) | - | 1918532..1918681 (+) | 150 | WP_003229910.1 | hypothetical protein | - |
| AS891_RS09950 (AS891_09945) | yqaN | 1918777..1919205 (+) | 429 | WP_009967809.1 | RusA family crossover junction endodeoxyribonuclease | - |
| AS891_RS09955 (AS891_09950) | yqaO | 1919287..1919493 (+) | 207 | WP_003229912.1 | XtrA/YqaO family protein | - |
| AS891_RS09960 (AS891_09955) | - | 1919567..1920496 (-) | 930 | WP_003229913.1 | hypothetical protein | - |
| AS891_RS09965 (AS891_09960) | yqaQ | 1920694..1921149 (+) | 456 | WP_004398775.1 | hypothetical protein | - |
| AS891_RS09970 (AS891_09965) | - | 1921293..1921757 (+) | 465 | WP_004398685.1 | hypothetical protein | - |
| AS891_RS09975 (AS891_09970) | terS | 1921825..1922544 (+) | 720 | WP_003229916.1 | phage terminase small subunit | - |
| AS891_RS09980 (AS891_09975) | stmB | 1922537..1923832 (+) | 1296 | WP_003229917.1 | PBSX family phage terminase large subunit | - |
| AS891_RS09985 (AS891_09980) | yqbA | 1923836..1925368 (+) | 1533 | WP_004398894.1 | phage portal protein | - |
| AS891_RS09990 (AS891_09985) | yqbB | 1925365..1926282 (+) | 918 | WP_004398748.1 | phage head morphogenesis protein | - |
| AS891_RS09995 (AS891_09990) | - | 1926323..1926976 (+) | 654 | WP_003229920.1 | hypothetical protein | - |
| AS891_RS10000 (AS891_09995) | yqbD | 1927009..1927977 (+) | 969 | WP_003229921.1 | XkdF-like putative serine protease domain-containing protein | - |
| AS891_RS10005 (AS891_10000) | skdG | 1927996..1928931 (+) | 936 | WP_003229922.1 | phage major capsid protein | - |
| AS891_RS10010 (AS891_10005) | yqbF | 1928942..1929253 (+) | 312 | WP_003229923.1 | YqbF domain-containing protein | - |
| AS891_RS10015 (AS891_10010) | gkpG | 1929257..1929652 (+) | 396 | WP_004398566.1 | DUF3199 family protein | - |
| AS891_RS10020 (AS891_10015) | yqbH | 1929649..1930011 (+) | 363 | WP_003229925.1 | YqbH/XkdH family protein | - |
| AS891_RS10025 (AS891_10020) | yqbI | 1930008..1930511 (+) | 504 | WP_003246050.1 | HK97 gp10 family phage protein | - |
| AS891_RS10030 (AS891_10025) | yqbJ | 1930524..1930961 (+) | 438 | WP_003229927.1 | phage tail terminator family protein | - |
| AS891_RS10035 (AS891_10030) | - | 1930958..1931149 (+) | 192 | WP_010886574.1 | hypothetical protein | - |
| AS891_RS10040 (AS891_10035) | yqbK | 1931150..1932550 (+) | 1401 | WP_003229929.1 | phage tail sheath family protein | - |
| AS891_RS10045 (AS891_10040) | yqbM | 1932553..1932996 (+) | 444 | WP_003229930.1 | phage tail tube protein | - |
| AS891_RS22880 | bsrH | 1933250..1933339 (-) | 90 | WP_075058862.1 | type I toxin-antitoxin system toxin BsrH | - |
| AS891_RS10050 (AS891_10045) | txpA | 1933719..1933898 (-) | 180 | WP_004398662.1 | type I toxin-antitoxin system toxin TxpA | - |
| AS891_RS10055 (AS891_10050) | - | 1934044..1934493 (+) | 450 | WP_003229933.1 | phage tail assembly chaperone | - |
| AS891_RS10060 (AS891_10055) | - | 1934535..1934672 (+) | 138 | WP_003229934.1 | hypothetical protein | - |
| AS891_RS10065 (AS891_10060) | yqbO | 1934675..1939432 (+) | 4758 | WP_003246092.1 | phage tail tape measure protein | - |
| AS891_RS10070 (AS891_10065) | yqbP | 1939425..1940084 (+) | 660 | WP_004398548.1 | LysM peptidoglycan-binding domain-containing protein | - |
| AS891_RS10075 (AS891_10070) | yqbQ | 1940097..1941077 (+) | 981 | WP_004398524.1 | XkdQ/YqbQ family protein | - |
| AS891_RS10080 (AS891_10075) | yqbR | 1941074..1941337 (+) | 264 | WP_003229938.1 | DUF2577 family protein | - |
| AS891_RS10085 (AS891_10080) | yqbS | 1941350..1941775 (+) | 426 | WP_004398572.1 | DUF2634 domain-containing protein | - |
| AS891_RS10090 (AS891_10085) | yqbT | 1941768..1942814 (+) | 1047 | WP_003229940.1 | baseplate J/gp47 family protein | - |
| AS891_RS10095 (AS891_10090) | yqcA | 1942798..1943376 (+) | 579 | WP_003229941.1 | YmfQ family protein | - |
| AS891_RS10100 (AS891_10095) | - | 1943373..1943645 (+) | 273 | WP_003229942.1 | hypothetical protein | - |
| AS891_RS10105 (AS891_10100) | yqcC | 1943648..1944748 (+) | 1101 | WP_003229943.1 | pyocin knob domain-containing protein | - |
| AS891_RS10110 (AS891_10105) | yqcD | 1944758..1945093 (+) | 336 | WP_009967793.1 | XkdW family protein | - |
| AS891_RS10115 (AS891_10110) | yqcE | 1945090..1945254 (+) | 165 | WP_003229944.1 | XkdX family protein | - |
| AS891_RS10120 (AS891_10115) | xepA | 1945342..1946235 (+) | 894 | WP_003246010.1 | phage-like element PBSX protein XepA | - |
| AS891_RS10125 (AS891_10120) | skhD | 1946280..1946702 (+) | 423 | WP_003246208.1 | phage holin family protein | - |
| AS891_RS10130 (AS891_10125) | cwlA | 1946747..1947565 (+) | 819 | WP_003229946.1 | N-acetylmuramoyl-L-alanine amidase CwlA | - |
| AS891_RS10135 (AS891_10130) | - | 1947730..1948209 (+) | 480 | WP_004399085.1 | hypothetical protein | - |
| AS891_RS10140 (AS891_10135) | - | 1948225..1948587 (+) | 363 | WP_003229947.1 | hypothetical protein | - |
| AS891_RS22885 (AS891_10140) | - | 1948584..1948730 (-) | 147 | WP_009967791.1 | hypothetical protein | - |
| AS891_RS10150 (AS891_10145) | yqcF | 1948848..1949426 (-) | 579 | WP_009967790.1 | type VII secretion system immunity protein YqcF | - |
| AS891_RS10155 (AS891_10150) | yqcG | 1949441..1951036 (-) | 1596 | WP_004399034.1 | LXG family T7SS effector endonuclease toxin YqcG | - |
| AS891_RS23325 | - | 1951152..1951442 (-) | 291 | WP_418910793.1 | hypothetical protein | - |
| AS891_RS10160 (AS891_10155) | - | 1951406..1951564 (-) | 159 | WP_003245945.1 | hypothetical protein | - |
| AS891_RS10165 (AS891_10160) | phrE | 1951674..1951808 (-) | 135 | WP_004398770.1 | phosphatase RapE inhibitor PhrE | - |
| AS891_RS10170 (AS891_10165) | rapE | 1951798..1952925 (-) | 1128 | WP_004398842.1 | response regulator aspartate phosphatase RapE | - |
| AS891_RS10175 (AS891_10170) | yqcI | 1953368..1954132 (+) | 765 | WP_004398670.1 | YqcI/YcgG family protein | - |
| AS891_RS10180 (AS891_10175) | arsR | 1954504..1954821 (+) | 318 | WP_004399122.1 | arsenical resistance operon transcriptional regulator ArsR | - |
| AS891_RS10185 (AS891_10180) | arsK | 1954882..1955322 (+) | 441 | WP_003229954.1 | ArsI/CadI family heavy metal resistance metalloenzyme | - |
| AS891_RS10190 (AS891_10185) | acr3 | 1955345..1956385 (+) | 1041 | WP_004398718.1 | arsenite efflux transporter Acr3 | - |
| AS891_RS10195 (AS891_10190) | arsC | 1956397..1956816 (+) | 420 | WP_004398596.1 | thioredoxin-dependent arsenate reductase | - |
| AS891_RS23165 | - | 1957171..1957349 (+) | 179 | Protein_1963 | hypothetical protein | - |
| AS891_RS10200 (AS891_10195) | spoIVCA | 1957307..1958767 (+) | 1461 | WP_223257626.1 | site-specific DNA recombinase SpoIVCA | - |
| AS891_RS10205 (AS891_10200) | - | 1958795..1959145 (-) | 351 | Protein_1965 | sigma-70 family RNA polymerase sigma factor | - |
| AS891_RS10210 (AS891_10205) | nucA/comI | 1959341..1959751 (+) | 411 | WP_009967785.1 | sporulation-specific Dnase NucB | Machinery gene |
| AS891_RS10215 (AS891_10210) | yqeB | 1959784..1960506 (-) | 723 | WP_010886572.1 | hypothetical protein | - |
| AS891_RS10220 (AS891_10215) | gnd | 1960758..1961651 (+) | 894 | WP_003229961.1 | phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) | - |
| AS891_RS10225 (AS891_10220) | yqeD | 1961670..1962296 (-) | 627 | WP_003229962.1 | TVP38/TMEM64 family protein | - |
| AS891_RS10230 (AS891_10225) | cwlH | 1962483..1963235 (+) | 753 | WP_003229963.1 | N-acetylmuramoyl-L-alanine amidase CwlH | - |
| AS891_RS10235 (AS891_10230) | yqeF | 1963487..1964218 (+) | 732 | WP_003229964.1 | SGNH/GDSL hydrolase family protein | - |
| AS891_RS10245 (AS891_10240) | - | 1964524..1964664 (-) | 141 | WP_003226124.1 | sporulation histidine kinase inhibitor Sda | - |
| AS891_RS10250 (AS891_10245) | yqeG | 1965026..1965544 (+) | 519 | WP_003226126.1 | YqeG family HAD IIIA-type phosphatase | - |
| AS891_RS10255 (AS891_10250) | yqeH | 1965548..1966648 (+) | 1101 | WP_003229966.1 | ribosome biogenesis GTPase YqeH | - |
| AS891_RS10260 (AS891_10255) | aroE | 1966666..1967508 (+) | 843 | WP_003229967.1 | shikimate dehydrogenase | - |
| AS891_RS10265 (AS891_10260) | yhbY | 1967502..1967792 (+) | 291 | WP_003226133.1 | ribosome assembly RNA-binding protein YhbY | - |
| AS891_RS10270 (AS891_10265) | nadD | 1967804..1968373 (+) | 570 | WP_004398676.1 | nicotinate-nucleotide adenylyltransferase | - |
| AS891_RS10275 (AS891_10270) | yqeK | 1968363..1968923 (+) | 561 | WP_004399059.1 | bis(5'-nucleosyl)-tetraphosphatase (symmetrical) YqeK | - |
| AS891_RS10280 (AS891_10275) | rsfS | 1968941..1969297 (+) | 357 | WP_003229971.1 | ribosome silencing factor | - |
| AS891_RS10285 (AS891_10280) | yqeM | 1969294..1970037 (+) | 744 | WP_003229973.1 | class I SAM-dependent DNA methyltransferase | - |
| AS891_RS10290 (AS891_10285) | comER | 1970103..1970924 (-) | 822 | WP_004398597.1 | late competence protein ComER | - |
| AS891_RS10295 (AS891_10290) | comEA | 1971008..1971625 (+) | 618 | WP_004398514.1 | competence protein ComEA | Machinery gene |
| AS891_RS10300 (AS891_10295) | comEB | 1971692..1972261 (+) | 570 | WP_003229978.1 | ComE operon protein 2 | - |
| AS891_RS10305 (AS891_10300) | comEC | 1972265..1974595 (+) | 2331 | WP_009967776.1 | DNA internalization-related competence protein ComEC/Rec2 | Machinery gene |
Sequence
Protein
Download Length: 136 a.a. Molecular weight: 14967.97 Da Isoelectric Point: 5.1853
>NTDB_id=178908 AS891_RS10210 WP_009967785.1 1959341..1959751(+) (nucA/comI) [Bacillus subtilis subsp. subtilis strain KCTC 3135]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
Nucleotide
Download Length: 411 bp
>NTDB_id=178908 AS891_RS10210 WP_009967785.1 1959341..1959751(+) (nucA/comI) [Bacillus subtilis subsp. subtilis strain KCTC 3135]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGGGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGTGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGTACCAGAGTGCTGTTTA
TTGTGCAGTAG
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGGGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGTGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGTACCAGAGTGCTGTTTA
TTGTGCAGTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| nucA/comI | Bacillus subtilis subsp. subtilis str. 168 |
62.609 |
84.559 |
0.529 |