Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   AS891_RS06975 Genome accession   NZ_CP015375
Coordinates   1356116..1356283 (+) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus subtilis subsp. subtilis strain KCTC 3135     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 1351116..1361283
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AS891_RS06950 (AS891_06945) pncB 1351261..1352733 (+) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  AS891_RS06955 (AS891_06950) pdeH 1352870..1354099 (+) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  AS891_RS06960 (AS891_06955) - 1354075..1354443 (-) 369 WP_003243784.1 hypothetical protein -
  AS891_RS22785 - 1354557..1354682 (-) 126 WP_003228793.1 hypothetical protein -
  AS891_RS06965 (AS891_06960) degQ 1354904..1355044 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  AS891_RS06970 (AS891_06965) comQ 1355229..1356128 (+) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  AS891_RS06975 (AS891_06970) comX 1356116..1356283 (+) 168 WP_003242801.1 competence pheromone ComX Regulator
  AS891_RS06980 (AS891_06975) comP 1356298..1358607 (+) 2310 WP_003242894.1 two-component system sensor histidine kinase ComP Regulator
  AS891_RS06985 (AS891_06980) comA 1358688..1359332 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  AS891_RS06990 (AS891_06985) yuxO 1359351..1359731 (+) 381 WP_003228810.1 hotdog fold thioesterase -
  AS891_RS06995 (AS891_06990) mnhG 1359770..1360144 (-) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  AS891_RS07000 (AS891_06995) mrpF 1360128..1360412 (-) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  AS891_RS07005 (AS891_07000) mrpE 1360412..1360888 (-) 477 WP_003244015.1 Na+/H+ antiporter subunit E -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=178897 AS891_RS06975 WP_003242801.1 1356116..1356283(+) (comX) [Bacillus subtilis subsp. subtilis strain KCTC 3135]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=178897 AS891_RS06975 WP_003242801.1 1356116..1356283(+) (comX) [Bacillus subtilis subsp. subtilis strain KCTC 3135]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G9LQ80

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment