Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | BT246_RS12750 | Genome accession | NZ_CP015350 |
| Coordinates | 2458015..2458293 (+) | Length | 92 a.a. |
| NCBI ID | WP_065483587.1 | Uniprot ID | A0A9W3X0K6 |
| Organism | Bacillus thuringiensis strain MYBT18246 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2455294..2488392 | 2458015..2458293 | within | 0 |
Gene organization within MGE regions
Location: 2455294..2488392
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BT246_RS12735 (BT246_26320) | - | 2455303..2456447 (+) | 1145 | WP_094194618.1 | IS3 family transposase | - |
| BT246_RS12740 (BT246_26330) | - | 2457115..2457327 (-) | 213 | WP_000033159.1 | hypothetical protein | - |
| BT246_RS12745 | - | 2457622..2458011 (+) | 390 | Protein_2474 | DnaD domain-containing protein | - |
| BT246_RS12750 (BT246_26350) | abrB | 2458015..2458293 (+) | 279 | WP_065483587.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| BT246_RS12755 (BT246_26360) | - | 2458286..2458645 (+) | 360 | WP_065483588.1 | cell division protein SepF | - |
| BT246_RS12760 (BT246_26370) | - | 2458664..2458831 (+) | 168 | WP_006923988.1 | DUF3954 domain-containing protein | - |
| BT246_RS12765 (BT246_26380) | - | 2458857..2459108 (+) | 252 | WP_006923989.1 | hypothetical protein | - |
| BT246_RS12770 (BT246_26390) | - | 2459128..2459637 (+) | 510 | Protein_2479 | dUTP diphosphatase | - |
| BT246_RS12785 (BT246_26420) | - | 2462051..2462437 (-) | 387 | WP_006923995.1 | hypothetical protein | - |
| BT246_RS12790 (BT246_26430) | - | 2462945..2463409 (-) | 465 | WP_016122509.1 | hypothetical protein | - |
| BT246_RS12795 (BT246_26450) | - | 2465600..2466856 (-) | 1257 | WP_065481512.1 | IS110 family transposase | - |
| BT246_RS12800 (BT246_26460) | - | 2467263..2467745 (+) | 483 | WP_065483591.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| BT246_RS12805 (BT246_26470) | - | 2467745..2468287 (+) | 543 | WP_065483594.1 | site-specific integrase | - |
| BT246_RS12810 (BT246_26480) | - | 2468815..2469669 (+) | 855 | WP_049107805.1 | alpha/beta fold hydrolase | - |
| BT246_RS12815 (BT246_26490) | - | 2469843..2470043 (-) | 201 | WP_000858032.1 | hypothetical protein | - |
| BT246_RS12820 (BT246_26500) | - | 2470668..2471069 (+) | 402 | WP_065483597.1 | hypothetical protein | - |
| BT246_RS12825 | - | 2471477..2471689 (+) | 213 | WP_065486066.1 | hypothetical protein | - |
| BT246_RS39710 | - | 2472214..2472372 (+) | 159 | Protein_2490 | ABC transporter ATP-binding protein | - |
| BT246_RS12835 (BT246_26530) | - | 2472426..2473136 (+) | 711 | WP_065483603.1 | class I SAM-dependent methyltransferase | - |
| BT246_RS12840 (BT246_26540) | - | 2473255..2473662 (+) | 408 | WP_000072495.1 | VOC family protein | - |
| BT246_RS12845 (BT246_26550) | - | 2474004..2474786 (+) | 783 | WP_065483606.1 | class I SAM-dependent methyltransferase | - |
| BT246_RS12850 (BT246_26560) | - | 2474944..2476620 (-) | 1677 | WP_141550274.1 | alpha-keto acid decarboxylase family protein | - |
| BT246_RS12855 (BT246_26570) | - | 2476737..2477219 (+) | 483 | WP_000191889.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| BT246_RS12860 (BT246_26580) | gpmA | 2477386..2478123 (+) | 738 | WP_053564492.1 | 2,3-diphosphoglycerate-dependent phosphoglycerate mutase | - |
| BT246_RS12865 (BT246_26590) | - | 2478362..2479099 (+) | 738 | WP_065483612.1 | type II toxin-antitoxin system SpoIISA family toxin | - |
| BT246_RS12870 (BT246_26600) | - | 2479212..2479340 (+) | 129 | WP_000237818.1 | hypothetical protein | - |
| BT246_RS12875 (BT246_26610) | spoIISB | 2479413..2479589 (+) | 177 | WP_065483615.1 | stage II sporulation protein SB | - |
| BT246_RS12880 (BT246_26620) | - | 2479606..2479995 (-) | 390 | WP_065483618.1 | YxeA family protein | - |
| BT246_RS12885 (BT246_26630) | pepD | 2480207..2481676 (+) | 1470 | WP_065483622.1 | beta-Ala-His dipeptidase | - |
| BT246_RS12890 (BT246_26640) | - | 2481922..2482731 (+) | 810 | WP_065483624.1 | papain-like cysteine protease family protein | - |
| BT246_RS12895 (BT246_26650) | - | 2482757..2483359 (+) | 603 | WP_065483627.1 | hypothetical protein | - |
| BT246_RS12900 (BT246_26660) | - | 2483668..2484849 (+) | 1182 | WP_023521943.1 | agmatine deiminase family protein | - |
| BT246_RS12905 (BT246_26670) | - | 2485323..2485574 (-) | 252 | WP_000827555.1 | response regulator transcription factor | - |
| BT246_RS35690 (BT246_26680) | - | 2485950..2486065 (+) | 116 | Protein_2506 | helix-turn-helix domain-containing protein | - |
| BT246_RS12920 (BT246_26710) | - | 2487203..2487973 (+) | 771 | Protein_2508 | transcriptional regulator | - |
| BT246_RS12925 (BT246_26720) | abrB | 2488114..2488392 (+) | 279 | WP_000842216.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
Sequence
Protein
Download Length: 92 a.a. Molecular weight: 10168.91 Da Isoelectric Point: 6.7189
>NTDB_id=178771 BT246_RS12750 WP_065483587.1 2458015..2458293(+) (abrB) [Bacillus thuringiensis strain MYBT18246]
MKNTGVARKVDELGRVVIPIELRRTLGIAEGMALDFHIDGENIVLRKHEKSCFVTGEISETNIELLGGRMFLSKEGVIEL
LNLIQKSGLVHA
MKNTGVARKVDELGRVVIPIELRRTLGIAEGMALDFHIDGENIVLRKHEKSCFVTGEISETNIELLGGRMFLSKEGVIEL
LNLIQKSGLVHA
Nucleotide
Download Length: 279 bp
>NTDB_id=178771 BT246_RS12750 WP_065483587.1 2458015..2458293(+) (abrB) [Bacillus thuringiensis strain MYBT18246]
ATGAAAAACACAGGCGTTGCAAGAAAAGTCGATGAGCTAGGTCGCGTAGTAATTCCGATAGAGTTACGTAGAACTTTAGG
GATTGCCGAAGGAATGGCACTAGATTTTCATATCGATGGTGAAAACATTGTTTTAAGAAAACATGAAAAGTCATGCTTTG
TAACCGGTGAAATTTCTGAAACCAACATAGAGTTGCTAGGTGGCCGAATGTTTTTGAGTAAGGAAGGGGTAATTGAATTA
CTGAATCTTATTCAGAAGAGTGGGCTGGTACATGCCTAA
ATGAAAAACACAGGCGTTGCAAGAAAAGTCGATGAGCTAGGTCGCGTAGTAATTCCGATAGAGTTACGTAGAACTTTAGG
GATTGCCGAAGGAATGGCACTAGATTTTCATATCGATGGTGAAAACATTGTTTTAAGAAAACATGAAAAGTCATGCTTTG
TAACCGGTGAAATTTCTGAAACCAACATAGAGTTGCTAGGTGGCCGAATGTTTTTGAGTAAGGAAGGGGTAATTGAATTA
CTGAATCTTATTCAGAAGAGTGGGCTGGTACATGCCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
58.621 |
94.565 |
0.554 |