Detailed information
Bioinformatically predicted
Overview
| Name | sinR | Type | Regulator |
| Locus tag | BTI247_RS07665 | Genome accession | NZ_CP015250 |
| Coordinates | 1493358..1493681 (-) | Length | 107 a.a. |
| NCBI ID | WP_000578885.1 | Uniprot ID | A0A9W5VG71 |
| Organism | Bacillus thuringiensis Bt18247 | ||
| Function | repression of rok; repression of degU; repression of spo0A (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1458192..1496625 | 1493358..1493681 | within | 0 |
Gene organization within MGE regions
Location: 1458192..1496625
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BTI247_RS07440 (BTI247_15380) | - | 1458192..1458401 (+) | 210 | WP_069355230.1 | helix-turn-helix transcriptional regulator | - |
| BTI247_RS07445 (BTI247_15390) | - | 1458404..1458781 (+) | 378 | WP_048564894.1 | hypothetical protein | - |
| BTI247_RS07450 (BTI247_15400) | - | 1458810..1458992 (+) | 183 | WP_001178303.1 | DUF3976 domain-containing protein | - |
| BTI247_RS07455 (BTI247_15410) | - | 1459126..1459488 (+) | 363 | WP_069355231.1 | hypothetical protein | - |
| BTI247_RS34080 | - | 1459505..1459773 (+) | 269 | Protein_1421 | hypothetical protein | - |
| BTI247_RS07465 (BTI247_15420) | - | 1459913..1460509 (+) | 597 | WP_001169495.1 | DUF4878 domain-containing protein | - |
| BTI247_RS07470 | - | 1461222..1461356 (+) | 135 | WP_000723764.1 | SDR family oxidoreductase | - |
| BTI247_RS07475 (BTI247_15430) | - | 1461389..1462288 (+) | 900 | WP_000054715.1 | ABC transporter ATP-binding protein | - |
| BTI247_RS07480 (BTI247_15440) | - | 1462281..1463522 (+) | 1242 | WP_069355233.1 | ABC transporter permease | - |
| BTI247_RS07485 (BTI247_15450) | - | 1464248..1464505 (+) | 258 | WP_232339737.1 | helix-turn-helix transcriptional regulator | - |
| BTI247_RS07490 (BTI247_15460) | - | 1464524..1465144 (+) | 621 | WP_069355235.1 | hypothetical protein | - |
| BTI247_RS07495 (BTI247_15470) | - | 1465145..1465450 (+) | 306 | WP_069355236.1 | hypothetical protein | - |
| BTI247_RS07500 (BTI247_15480) | - | 1465486..1465704 (+) | 219 | WP_069355237.1 | hypothetical protein | - |
| BTI247_RS07505 (BTI247_15490) | - | 1465721..1466110 (+) | 390 | WP_069355238.1 | adenylate kinase | - |
| BTI247_RS33680 | - | 1466102..1466431 (-) | 330 | WP_069355239.1 | hypothetical protein | - |
| BTI247_RS07515 (BTI247_15510) | - | 1466642..1467193 (-) | 552 | WP_083594897.1 | hypothetical protein | - |
| BTI247_RS33685 | - | 1467642..1467848 (-) | 207 | WP_198174655.1 | hypothetical protein | - |
| BTI247_RS07520 (BTI247_15520) | - | 1467983..1468816 (+) | 834 | WP_069355240.1 | hypothetical protein | - |
| BTI247_RS07525 (BTI247_15530) | - | 1469422..1471269 (+) | 1848 | WP_069355241.1 | ATP-binding protein | - |
| BTI247_RS07530 (BTI247_15540) | - | 1471556..1471825 (+) | 270 | WP_069354784.1 | transposase | - |
| BTI247_RS07535 (BTI247_15550) | - | 1471780..1472679 (+) | 900 | WP_157452921.1 | IS3 family transposase | - |
| BTI247_RS07545 (BTI247_15570) | - | 1473421..1473777 (-) | 357 | WP_069355243.1 | MEMO1 family protein | - |
| BTI247_RS07550 (BTI247_15580) | - | 1473955..1474224 (-) | 270 | WP_069355244.1 | hypothetical protein | - |
| BTI247_RS07555 (BTI247_15590) | - | 1474927..1475133 (+) | 207 | Protein_1440 | recombinase family protein | - |
| BTI247_RS07560 (BTI247_15600) | - | 1475168..1476067 (-) | 900 | WP_157452921.1 | IS3 family transposase | - |
| BTI247_RS07565 (BTI247_15610) | - | 1476022..1476291 (-) | 270 | WP_069354784.1 | transposase | - |
| BTI247_RS07570 (BTI247_15620) | - | 1476360..1476746 (+) | 387 | Protein_1443 | recombinase family protein | - |
| BTI247_RS07575 (BTI247_15630) | - | 1476910..1478022 (+) | 1113 | WP_069354786.1 | IS110 family transposase | - |
| BTI247_RS07585 (BTI247_15650) | - | 1478877..1479107 (-) | 231 | WP_069355247.1 | hypothetical protein | - |
| BTI247_RS07590 (BTI247_15660) | - | 1479362..1479595 (-) | 234 | WP_069355248.1 | hypothetical protein | - |
| BTI247_RS07595 (BTI247_15670) | - | 1479914..1481179 (-) | 1266 | WP_069355249.1 | DEAD/DEAH box helicase family protein | - |
| BTI247_RS07600 (BTI247_15680) | istA | 1482116..1483411 (+) | 1296 | WP_069354782.1 | IS21 family transposase | - |
| BTI247_RS07605 (BTI247_15690) | istB | 1483401..1484153 (+) | 753 | WP_069354783.1 | IS21-like element IS232 family helper ATPase IstB | - |
| BTI247_RS07610 (BTI247_15700) | - | 1484150..1485082 (-) | 933 | WP_069355250.1 | tyrosine-type recombinase/integrase | - |
| BTI247_RS07620 (BTI247_15720) | - | 1485543..1486010 (-) | 468 | WP_069355251.1 | hypothetical protein | - |
| BTI247_RS07625 (BTI247_15730) | - | 1486618..1486839 (-) | 222 | WP_053564957.1 | hypothetical protein | - |
| BTI247_RS07630 (BTI247_15740) | - | 1487007..1487762 (-) | 756 | WP_069355252.1 | class I SAM-dependent methyltransferase | - |
| BTI247_RS07635 (BTI247_15750) | - | 1488284..1488511 (+) | 228 | WP_000251856.1 | hypothetical protein | - |
| BTI247_RS07640 (BTI247_15760) | - | 1488664..1489950 (+) | 1287 | WP_069355253.1 | D-alanyl-D-alanine carboxypeptidase family protein | - |
| BTI247_RS07645 (BTI247_15770) | - | 1490142..1490711 (+) | 570 | WP_000767792.1 | signal peptidase I | - |
| BTI247_RS07650 (BTI247_15780) | - | 1490774..1491361 (+) | 588 | WP_000172852.1 | CalY family protein | - |
| BTI247_RS07655 (BTI247_15790) | - | 1491496..1492338 (+) | 843 | WP_069355254.1 | DUF4047 domain-containing protein | - |
| BTI247_RS07660 (BTI247_15800) | calY | 1492725..1493318 (+) | 594 | WP_069355255.1 | biofilm matrix protein CalY | - |
| BTI247_RS07665 (BTI247_15810) | sinR | 1493358..1493681 (-) | 324 | WP_000578885.1 | helix-turn-helix domain-containing protein | Regulator |
| BTI247_RS07670 (BTI247_15820) | - | 1493761..1493895 (-) | 135 | WP_000276219.1 | anti-repressor SinI family protein | - |
| BTI247_RS07675 (BTI247_15830) | inhA1 | 1494238..1496625 (+) | 2388 | WP_069355256.1 | M6 family metalloprotease immune inhibitor InhA1 | - |
Sequence
Protein
Download Length: 107 a.a. Molecular weight: 12349.19 Da Isoelectric Point: 9.6244
>NTDB_id=178072 BTI247_RS07665 WP_000578885.1 1493358..1493681(-) (sinR) [Bacillus thuringiensis Bt18247]
MIGERIKRLRLQKGISLTELAEKAGVAKSYISSIERNLQKNPSIQFLEKIAAVLQIPVDTLLHDETTKETNLDSEWTQLV
KDAMNSGVSKEQFREFLEFTKWKQNQK
MIGERIKRLRLQKGISLTELAEKAGVAKSYISSIERNLQKNPSIQFLEKIAAVLQIPVDTLLHDETTKETNLDSEWTQLV
KDAMNSGVSKEQFREFLEFTKWKQNQK
Nucleotide
Download Length: 324 bp
>NTDB_id=178072 BTI247_RS07665 WP_000578885.1 1493358..1493681(-) (sinR) [Bacillus thuringiensis Bt18247]
ATGATTGGAGAACGTATAAAACGCCTTCGTTTACAAAAAGGGATTTCATTAACTGAACTTGCCGAAAAAGCTGGCGTTGC
TAAATCTTACATTAGTTCTATAGAACGAAATTTACAAAAAAACCCTTCCATTCAGTTTCTTGAAAAAATCGCAGCAGTTC
TACAAATTCCAGTTGATACTTTACTTCATGATGAAACAACAAAGGAAACTAACCTAGACTCCGAATGGACACAACTCGTT
AAAGATGCAATGAACTCTGGTGTCTCCAAAGAACAATTTCGTGAATTTCTTGAATTTACAAAGTGGAAGCAAAATCAAAA
ATAA
ATGATTGGAGAACGTATAAAACGCCTTCGTTTACAAAAAGGGATTTCATTAACTGAACTTGCCGAAAAAGCTGGCGTTGC
TAAATCTTACATTAGTTCTATAGAACGAAATTTACAAAAAAACCCTTCCATTCAGTTTCTTGAAAAAATCGCAGCAGTTC
TACAAATTCCAGTTGATACTTTACTTCATGATGAAACAACAAAGGAAACTAACCTAGACTCCGAATGGACACAACTCGTT
AAAGATGCAATGAACTCTGGTGTCTCCAAAGAACAATTTCGTGAATTTCTTGAATTTACAAAGTGGAAGCAAAATCAAAA
ATAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinR | Bacillus subtilis subsp. subtilis str. 168 |
67.89 |
100 |
0.692 |