Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   B14_RS05540 Genome accession   NZ_CP014842
Coordinates   1100146..1100286 (+) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   P69890
Organism   Bacillus licheniformis strain SCDB 14     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 1095146..1105286
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  B14_RS05510 (B14_01103) - 1095247..1095648 (+) 402 WP_003184870.1 YueI family protein -
  B14_RS05515 (B14_01104) - 1095833..1096384 (+) 552 WP_003184868.1 cysteine hydrolase family protein -
  B14_RS05520 (B14_01105) - 1096402..1097871 (+) 1470 WP_003184866.1 nicotinate phosphoribosyltransferase -
  B14_RS05525 (B14_01106) - 1098050..1099270 (+) 1221 WP_003184864.1 EAL and HDOD domain-containing protein -
  B14_RS05530 (B14_01107) - 1099313..1099660 (-) 348 WP_231105863.1 SDR family oxidoreductase -
  B14_RS05540 (B14_01109) degQ 1100146..1100286 (+) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  B14_RS05545 (B14_01110) - 1100475..1101356 (+) 882 WP_021837675.1 polyprenyl synthetase family protein -
  B14_RS05550 (B14_01111) comX 1101365..1101529 (+) 165 WP_003184853.1 competence pheromone ComX -
  B14_RS05555 (B14_01112) comP 1101552..1103858 (+) 2307 WP_003184851.1 ATP-binding protein Regulator
  B14_RS05560 (B14_01113) comA 1103945..1104583 (+) 639 WP_003184849.1 response regulator transcription factor Regulator
  B14_RS05565 (B14_01114) - 1104600..1104989 (+) 390 WP_003184847.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=174643 B14_RS05540 WP_003184860.1 1100146..1100286(+) (degQ) [Bacillus licheniformis strain SCDB 14]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=174643 B14_RS05540 WP_003184860.1 1100146..1100286(+) (degQ) [Bacillus licheniformis strain SCDB 14]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P69890

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652

Multiple sequence alignment