Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | B14_RS04120 | Genome accession | NZ_CP014842 |
| Coordinates | 837566..837850 (+) | Length | 94 a.a. |
| NCBI ID | WP_003185421.1 | Uniprot ID | A0A1Y0XQV9 |
| Organism | Bacillus licheniformis strain SCDB 14 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 836750..886117 | 837566..837850 | within | 0 |
Gene organization within MGE regions
Location: 836750..886117
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| B14_RS04110 (B14_00820) | - | 836750..837151 (-) | 402 | WP_009329609.1 | transcriptional regulator | - |
| B14_RS04115 (B14_00821) | - | 837304..837537 (+) | 234 | WP_085959538.1 | helix-turn-helix domain-containing protein | - |
| B14_RS04120 (B14_00822) | abrB | 837566..837850 (+) | 285 | WP_003185421.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| B14_RS04125 (B14_00823) | secG | 838021..838251 (+) | 231 | WP_003185418.1 | preprotein translocase subunit SecG | - |
| B14_RS04130 (B14_00824) | - | 838392..839138 (+) | 747 | WP_003185416.1 | alpha/beta hydrolase | - |
| B14_RS04135 (B14_00825) | rnr | 839152..841455 (+) | 2304 | WP_003185414.1 | ribonuclease R | - |
| B14_RS04140 (B14_00826) | smpB | 841567..842040 (+) | 474 | WP_009329604.1 | SsrA-binding protein SmpB | - |
| B14_RS04150 (B14_00828) | - | 842616..843710 (-) | 1095 | WP_021837735.1 | tyrosine-type recombinase/integrase | - |
| B14_RS04155 (B14_00829) | - | 843781..844419 (-) | 639 | WP_003185408.1 | LexA family protein | - |
| B14_RS04160 (B14_00830) | - | 844596..844814 (+) | 219 | WP_021837734.1 | helix-turn-helix domain-containing protein | - |
| B14_RS04165 (B14_00831) | - | 844838..845632 (+) | 795 | WP_011198327.1 | ORF6N domain-containing protein | - |
| B14_RS04170 | - | 845629..845817 (+) | 189 | WP_003185403.1 | helix-turn-helix transcriptional regulator | - |
| B14_RS04175 (B14_00832) | - | 845949..846137 (+) | 189 | WP_016886536.1 | hypothetical protein | - |
| B14_RS04180 (B14_00833) | - | 846195..846749 (+) | 555 | WP_003185401.1 | hypothetical protein | - |
| B14_RS22420 (B14_00835) | - | 846875..847033 (+) | 159 | WP_021837733.1 | hypothetical protein | - |
| B14_RS04185 (B14_00836) | - | 847030..847359 (-) | 330 | WP_021837732.1 | hypothetical protein | - |
| B14_RS04190 (B14_00837) | - | 847422..847688 (+) | 267 | WP_021837731.1 | YqaH family protein | - |
| B14_RS04195 (B14_00839) | - | 847776..848018 (+) | 243 | WP_011198322.1 | hypothetical protein | - |
| B14_RS04200 (B14_00840) | - | 848111..848668 (+) | 558 | WP_021837730.1 | host-nuclease inhibitor Gam family protein | - |
| B14_RS04205 (B14_00841) | - | 848672..849604 (+) | 933 | WP_011198320.1 | AAA family ATPase | - |
| B14_RS04210 (B14_00842) | - | 849604..850041 (+) | 438 | WP_009329263.1 | DUF669 domain-containing protein | - |
| B14_RS04215 (B14_00843) | - | 850102..852534 (+) | 2433 | WP_021837729.1 | phage/plasmid primase, P4 family | - |
| B14_RS04220 (B14_00844) | - | 852755..853126 (+) | 372 | WP_021837728.1 | hypothetical protein | - |
| B14_RS04225 (B14_00845) | - | 853104..853541 (+) | 438 | WP_021837727.1 | hypothetical protein | - |
| B14_RS04230 (B14_00846) | - | 853538..854077 (+) | 540 | WP_021837726.1 | ERCC4 domain-containing protein | - |
| B14_RS04235 (B14_00847) | fbpA | 854074..854244 (+) | 171 | WP_021837725.1 | Fur-regulated basic protein FbpA | - |
| B14_RS04240 (B14_00848) | - | 854247..854762 (+) | 516 | WP_021837724.1 | putative metallopeptidase | - |
| B14_RS04245 (B14_00849) | - | 854778..855155 (+) | 378 | WP_021837723.1 | YopX family protein | - |
| B14_RS04250 (B14_00851) | - | 855268..855648 (+) | 381 | WP_021837721.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| B14_RS04255 | cotD | 856399..856623 (+) | 225 | WP_006637235.1 | spore coat protein CotD | - |
| B14_RS04260 (B14_00852) | - | 856840..857067 (+) | 228 | WP_006637236.1 | hypothetical protein | - |
| B14_RS04265 (B14_00853) | - | 857265..857825 (+) | 561 | WP_021837719.1 | hypothetical protein | - |
| B14_RS04275 (B14_00855) | - | 858153..858527 (+) | 375 | WP_021837717.1 | HNH endonuclease | - |
| B14_RS04285 (B14_00856) | - | 858757..859272 (+) | 516 | WP_003185364.1 | phage terminase small subunit P27 family | - |
| B14_RS04290 (B14_00857) | - | 859269..860978 (+) | 1710 | WP_003185362.1 | terminase large subunit | - |
| B14_RS04295 (B14_00858) | - | 860990..861181 (+) | 192 | WP_021837716.1 | DUF1056 family protein | - |
| B14_RS04300 (B14_00859) | - | 861182..862492 (+) | 1311 | WP_021837715.1 | phage portal protein | - |
| B14_RS04305 (B14_00860) | - | 862437..863168 (+) | 732 | WP_021837714.1 | head maturation protease, ClpP-related | - |
| B14_RS04310 (B14_00861) | - | 863206..864489 (+) | 1284 | WP_021837713.1 | phage major capsid protein | - |
| B14_RS04315 (B14_00862) | - | 864513..864940 (+) | 428 | Protein_824 | collagen-like protein | - |
| B14_RS04320 (B14_00863) | - | 864961..865263 (+) | 303 | WP_021837712.1 | head-tail connector protein | - |
| B14_RS04325 (B14_00864) | - | 865253..865561 (+) | 309 | WP_003185349.1 | phage head closure protein | - |
| B14_RS04330 (B14_00865) | - | 865561..865959 (+) | 399 | WP_003185346.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| B14_RS04335 (B14_00866) | gp17 | 865956..866339 (+) | 384 | WP_021837711.1 | tail completion protein gp17 | - |
| B14_RS04340 (B14_00867) | - | 866354..866971 (+) | 618 | WP_003185341.1 | major tail protein | - |
| B14_RS04345 (B14_00868) | gpG | 867025..867387 (+) | 363 | WP_003185339.1 | phage tail assembly chaperone G | - |
| B14_RS04350 (B14_00870) | - | 867596..872071 (+) | 4476 | WP_021837710.1 | phage tail tape measure protein | - |
| B14_RS04355 (B14_00871) | - | 872068..872904 (+) | 837 | WP_003185333.1 | phage tail family protein | - |
| B14_RS04360 (B14_00872) | - | 872917..874629 (+) | 1713 | WP_003185331.1 | phage tail protein | - |
| B14_RS04365 (B14_00873) | - | 874665..876620 (+) | 1956 | WP_021837708.1 | right-handed parallel beta-helix repeat-containing protein | - |
| B14_RS04370 (B14_00874) | - | 876641..877978 (+) | 1338 | WP_021837707.1 | phage baseplate upper protein | - |
| B14_RS04375 (B14_00875) | - | 877991..878314 (+) | 324 | WP_003185326.1 | bZIP transcription factor | - |
| B14_RS04380 (B14_00876) | - | 878311..878496 (+) | 186 | WP_003185324.1 | XkdX family protein | - |
| B14_RS04385 (B14_00877) | - | 878559..878828 (+) | 270 | WP_009329192.1 | hemolysin XhlA family protein | - |
| B14_RS04390 (B14_00878) | - | 878844..879107 (+) | 264 | WP_011198302.1 | phage holin | - |
| B14_RS04395 (B14_00879) | - | 879159..880001 (+) | 843 | WP_021837706.1 | N-acetylmuramoyl-L-alanine amidase | - |
| B14_RS04400 (B14_00880) | - | 880075..880419 (-) | 345 | WP_021837705.1 | hypothetical protein | - |
| B14_RS22840 (B14_00881) | - | 880437..882158 (-) | 1722 | WP_021837704.1 | T7SS effector LXG polymorphic toxin | - |
| B14_RS22610 (B14_00882) | - | 882359..882502 (+) | 144 | WP_021837703.1 | hypothetical protein | - |
| B14_RS04420 (B14_00883) | - | 882757..882987 (+) | 231 | WP_021837701.1 | helix-turn-helix domain-containing protein | - |
| B14_RS04425 (B14_00884) | - | 883221..883772 (+) | 552 | WP_080623576.1 | hypothetical protein | - |
| B14_RS04430 (B14_00885) | - | 883833..884153 (+) | 321 | WP_021837699.1 | hypothetical protein | - |
| B14_RS04435 (B14_00886) | - | 884150..884566 (+) | 417 | WP_021837698.1 | protein-export chaperone SecB | - |
| B14_RS04440 | - | 884765..884857 (+) | 93 | Protein_848 | peptidoglycan-binding domain-containing protein | - |
| B14_RS04445 (B14_00888) | - | 885103..885672 (-) | 570 | WP_011198295.1 | hypothetical protein | - |
| B14_RS04450 (B14_00889) | - | 885899..886117 (+) | 219 | WP_026699399.1 | transcriptional regulator | - |
Sequence
Protein
Download Length: 94 a.a. Molecular weight: 10486.36 Da Isoelectric Point: 7.9620
>NTDB_id=174640 B14_RS04120 WP_003185421.1 837566..837850(+) (abrB) [Bacillus licheniformis strain SCDB 14]
MKNTGIVRRIDELGRVVLPVEMRRVLNINEKDPLEIYTDGENIILTKYAANMACLMTGDITTKNKTYAGGKIVLSPRGAE
MLLEDMMAALSEKK
MKNTGIVRRIDELGRVVLPVEMRRVLNINEKDPLEIYTDGENIILTKYAANMACLMTGDITTKNKTYAGGKIVLSPRGAE
MLLEDMMAALSEKK
Nucleotide
Download Length: 285 bp
>NTDB_id=174640 B14_RS04120 WP_003185421.1 837566..837850(+) (abrB) [Bacillus licheniformis strain SCDB 14]
GTGAAAAATACCGGGATTGTCCGGAGAATCGATGAGCTCGGCAGAGTCGTTCTCCCGGTCGAAATGCGCAGGGTGCTGAA
TATCAATGAAAAGGACCCGCTCGAAATATATACCGACGGCGAAAACATCATTTTGACAAAATACGCCGCAAACATGGCAT
GTTTGATGACCGGCGACATCACCACGAAAAATAAAACGTATGCGGGCGGCAAAATCGTACTCAGCCCGCGCGGAGCGGAA
ATGCTCCTGGAAGATATGATGGCGGCACTGTCAGAAAAGAAATAA
GTGAAAAATACCGGGATTGTCCGGAGAATCGATGAGCTCGGCAGAGTCGTTCTCCCGGTCGAAATGCGCAGGGTGCTGAA
TATCAATGAAAAGGACCCGCTCGAAATATATACCGACGGCGAAAACATCATTTTGACAAAATACGCCGCAAACATGGCAT
GTTTGATGACCGGCGACATCACCACGAAAAATAAAACGTATGCGGGCGGCAAAATCGTACTCAGCCCGCGCGGAGCGGAA
ATGCTCCTGGAAGATATGATGGCGGCACTGTCAGAAAAGAAATAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
56.044 |
96.809 |
0.543 |