Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   BCBMB205_RS02030 Genome accession   NZ_CP014838
Coordinates   397884..398003 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain CBMB205     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 392884..403003
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BCBMB205_RS02015 (BCBMB205_03660) - 394496..395179 (+) 684 WP_032872879.1 response regulator transcription factor -
  BCBMB205_RS02020 (BCBMB205_03670) - 395166..396599 (+) 1434 WP_161503657.1 sensor histidine kinase -
  BCBMB205_RS02025 (BCBMB205_03690) rapC 396752..397900 (+) 1149 WP_007410270.1 Rap family tetratricopeptide repeat protein Regulator
  BCBMB205_RS02030 (BCBMB205_03700) phrC 397884..398003 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  BCBMB205_RS02035 - 398154..398264 (-) 111 WP_369878517.1 YjcZ family sporulation protein -
  BCBMB205_RS02040 (BCBMB205_03720) - 398344..399708 (-) 1365 WP_007609394.1 aspartate kinase -
  BCBMB205_RS02045 (BCBMB205_03740) ceuB 400122..401075 (+) 954 WP_032872883.1 ABC transporter permease Machinery gene
  BCBMB205_RS02050 (BCBMB205_03750) - 401065..402012 (+) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  BCBMB205_RS02055 (BCBMB205_03760) - 402006..402764 (+) 759 WP_007609404.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=174519 BCBMB205_RS02030 WP_003156334.1 397884..398003(+) (phrC) [Bacillus velezensis strain CBMB205]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=174519 BCBMB205_RS02030 WP_003156334.1 397884..398003(+) (phrC) [Bacillus velezensis strain CBMB205]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGAGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718


Multiple sequence alignment