Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   BaDB11_RS04130 Genome accession   NZ_CP014795
Coordinates   740641..740817 (+) Length   58 a.a.
NCBI ID   WP_003183444.1    Uniprot ID   -
Organism   Bacillus licheniformis strain SCK B11     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 735641..745817
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BaDB11_RS04115 (BaDB11_00836) gcvT 736283..737377 (-) 1095 WP_003183436.1 glycine cleavage system aminomethyltransferase GcvT -
  BaDB11_RS04120 (BaDB11_00837) - 737970..739649 (+) 1680 WP_003183439.1 DEAD/DEAH box helicase -
  BaDB11_RS04125 (BaDB11_00838) - 739656..740450 (+) 795 WP_003183441.1 YqhG family protein -
  BaDB11_RS04130 (BaDB11_00839) sinI 740641..740817 (+) 177 WP_003183444.1 anti-repressor SinI Regulator
  BaDB11_RS04135 (BaDB11_00840) sinR 740851..741186 (+) 336 WP_025804940.1 transcriptional regulator SinR Regulator
  BaDB11_RS04140 (BaDB11_00841) tasA 741291..742085 (-) 795 WP_003183447.1 biofilm matrix protein TasA -
  BaDB11_RS04145 (BaDB11_00842) sipW 742159..742743 (-) 585 WP_003183449.1 signal peptidase I SipW -
  BaDB11_RS04150 (BaDB11_00843) tapA 742740..743468 (-) 729 WP_003183451.1 amyloid fiber anchoring/assembly protein TapA -
  BaDB11_RS04155 (BaDB11_00844) - 743745..744065 (+) 321 WP_003183454.1 YqzG/YhdC family protein -
  BaDB11_RS04160 (BaDB11_00845) - 744089..744271 (-) 183 WP_003183456.1 YqzE family protein -
  BaDB11_RS04165 (BaDB11_00846) comGG 744360..744725 (-) 366 WP_003183459.1 competence type IV pilus minor pilin ComGG -
  BaDB11_RS04170 (BaDB11_00847) comGF 744738..745226 (-) 489 WP_011201694.1 competence type IV pilus minor pilin ComGF -
  BaDB11_RS04175 comGE 745135..745482 (-) 348 WP_009327907.1 competence type IV pilus minor pilin ComGE -

Sequence


Protein


Download         Length: 58 a.a.        Molecular weight: 6724.47 Da        Isoelectric Point: 4.7616

>NTDB_id=174294 BaDB11_RS04130 WP_003183444.1 740641..740817(+) (sinI) [Bacillus licheniformis strain SCK B11]
MNKDKNEKEELDEEWTDLIKHALEQGISPEEIRIFLNLGKKSSNPSTSIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=174294 BaDB11_RS04130 WP_003183444.1 740641..740817(+) (sinI) [Bacillus licheniformis strain SCK B11]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGACTTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGAGGAAATACGTATTTTTCTCAATTTGGGAAAGAAGTCTTCAAATCCTTCCACATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

51.724

100

0.517


Multiple sequence alignment