Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   B37_RS14925 Genome accession   NZ_CP014794
Coordinates   2808089..2808229 (-) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   P69890
Organism   Bacillus licheniformis strain SCCB 37     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2803089..2813229
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  B37_RS14900 (B37_03008) - 2803409..2803798 (-) 390 WP_009329508.1 hotdog fold thioesterase -
  B37_RS14905 (B37_03009) comA 2803815..2804453 (-) 639 WP_003184849.1 response regulator transcription factor Regulator
  B37_RS14910 (B37_03010) comP 2804540..2806840 (-) 2301 WP_009329509.1 ATP-binding protein Regulator
  B37_RS14915 (B37_03011) comX 2806842..2807015 (-) 174 WP_009329510.1 competence pheromone ComX -
  B37_RS14920 (B37_03012) - 2807019..2807900 (-) 882 WP_009329511.1 polyprenyl synthetase family protein -
  B37_RS14925 (B37_03013) degQ 2808089..2808229 (-) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  B37_RS14935 (B37_03015) - 2808715..2809062 (+) 348 WP_009329512.1 hypothetical protein -
  B37_RS14940 (B37_03016) - 2809105..2810325 (-) 1221 WP_003184864.1 EAL and HDOD domain-containing protein -
  B37_RS14945 (B37_03017) - 2810504..2811913 (-) 1410 WP_228767691.1 nicotinate phosphoribosyltransferase -
  B37_RS14950 (B37_03018) - 2811991..2812542 (-) 552 WP_003184868.1 cysteine hydrolase family protein -
  B37_RS14955 (B37_03019) - 2812727..2813128 (-) 402 WP_003184870.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=174263 B37_RS14925 WP_003184860.1 2808089..2808229(-) (degQ) [Bacillus licheniformis strain SCCB 37]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=174263 B37_RS14925 WP_003184860.1 2808089..2808229(-) (degQ) [Bacillus licheniformis strain SCCB 37]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATTTAAAAACCTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P69890

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652

Multiple sequence alignment