Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   BSR20_RS09540 Genome accession   NZ_CP018189
Coordinates   2053092..2053322 (-) Length   76 a.a.
NCBI ID   WP_013991265.1    Uniprot ID   -
Organism   Streptococcus salivarius strain ICDC3     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2048092..2058322
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSR20_RS09505 (BSR20_09610) - 2048482..2048928 (-) 447 WP_045001368.1 hypothetical protein -
  BSR20_RS09510 (BSR20_09615) - 2049006..2049662 (-) 657 WP_014632546.1 CPBP family intramembrane glutamic endopeptidase -
  BSR20_RS09515 (BSR20_09620) - 2049674..2049871 (-) 198 WP_002885716.1 helix-turn-helix transcriptional regulator -
  BSR20_RS09520 (BSR20_09625) - 2050122..2051315 (-) 1194 WP_002885831.1 acetate kinase -
  BSR20_RS09525 (BSR20_09630) comGH 2051372..2052328 (-) 957 WP_014632544.1 class I SAM-dependent methyltransferase Machinery gene
  BSR20_RS09530 (BSR20_09635) comGG 2052373..2052690 (-) 318 WP_045001363.1 competence type IV pilus minor pilin ComGG Machinery gene
  BSR20_RS09535 (BSR20_09640) comGF 2052668..2053105 (-) 438 WP_014632542.1 competence type IV pilus minor pilin ComGF Machinery gene
  BSR20_RS09540 (BSR20_09645) comGE 2053092..2053322 (-) 231 WP_013991265.1 competence type IV pilus minor pilin ComGE Machinery gene
  BSR20_RS09545 (BSR20_09650) comGD 2053354..2053782 (-) 429 WP_269434102.1 competence type IV pilus minor pilin ComGD Machinery gene
  BSR20_RS09550 (BSR20_09655) comGC 2053742..2054056 (-) 315 WP_037611125.1 competence type IV pilus major pilin ComGC Machinery gene
  BSR20_RS09555 (BSR20_09660) comGB 2054065..2055165 (-) 1101 WP_156209968.1 competence type IV pilus assembly protein ComGB Machinery gene
  BSR20_RS09560 (BSR20_09665) comGA 2055047..2055988 (-) 942 WP_045771803.1 competence type IV pilus ATPase ComGA Machinery gene
  BSR20_RS09565 (BSR20_09670) - 2056068..2056430 (-) 363 WP_002887019.1 DUF1033 family protein -

Sequence


Protein


Download         Length: 76 a.a.        Molecular weight: 8399.82 Da        Isoelectric Point: 10.4655

>NTDB_id=173789 BSR20_RS09540 WP_013991265.1 2053092..2053322(-) (comGE) [Streptococcus salivarius strain ICDC3]
MAVLVLVSGLILDQINTNRRLMARNLHQQEVLSVATMAVQTKQDQLTLNGITVTVKRSKQGIAVYESGKEIIHVSQ

Nucleotide


Download         Length: 231 bp        

>NTDB_id=173789 BSR20_RS09540 WP_013991265.1 2053092..2053322(-) (comGE) [Streptococcus salivarius strain ICDC3]
ATGGCTGTCTTAGTACTCGTCAGTGGTCTTATCTTGGATCAGATCAATACCAATCGTAGGCTAATGGCTAGGAATCTCCA
CCAACAGGAGGTTTTGAGTGTGGCAACCATGGCAGTTCAGACCAAACAGGATCAGTTGACCTTAAATGGCATCACAGTGA
CAGTAAAACGTAGCAAGCAAGGTATCGCGGTTTACGAATCAGGAAAGGAGATTATTCATGTCTCTCAATAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Streptococcus mutans UA140

37.838

97.368

0.368

  comGE Streptococcus mutans UA159

37.838

97.368

0.368