Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   AS588_RS14485 Genome accession   NZ_CP014700
Coordinates   3022596..3022736 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus amyloliquefaciens strain S499     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3017596..3027736
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AS588_RS14460 (AS588_14460) - 3017936..3018319 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  AS588_RS14465 (AS588_14465) comA 3018341..3018985 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  AS588_RS14470 (AS588_14470) comP 3019066..3021357 (-) 2292 WP_015387784.1 histidine kinase Regulator
  AS588_RS14475 (AS588_14475) comX 3021369..3021533 (-) 165 WP_007613432.1 competence pheromone ComX -
  AS588_RS14480 (AS588_14480) - 3021533..3022444 (-) 912 WP_014305720.1 polyprenyl synthetase family protein -
  AS588_RS14485 (AS588_14485) degQ 3022596..3022736 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  AS588_RS14490 (AS588_14490) - 3023202..3023543 (+) 342 WP_014305721.1 hypothetical protein -
  AS588_RS14495 (AS588_14495) - 3023550..3024770 (-) 1221 WP_015387782.1 EAL and HDOD domain-containing protein -
  AS588_RS14500 (AS588_14500) - 3024900..3026366 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  AS588_RS14505 (AS588_14505) - 3026384..3026935 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  AS588_RS14510 (AS588_14510) - 3027032..3027430 (-) 399 WP_003152031.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=173450 AS588_RS14485 WP_003152043.1 3022596..3022736(-) (degQ) [Bacillus amyloliquefaciens strain S499]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=173450 AS588_RS14485 WP_003152043.1 3022596..3022736(-) (degQ) [Bacillus amyloliquefaciens strain S499]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891


Multiple sequence alignment