Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | AS588_RS03975 | Genome accession | NZ_CP014700 |
| Coordinates | 786750..786923 (-) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus amyloliquefaciens strain S499 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 781750..791923
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AS588_RS03925 (AS588_03925) | comGD | 781870..782307 (+) | 438 | WP_015388002.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| AS588_RS03930 (AS588_03930) | comGE | 782291..782605 (+) | 315 | WP_015388003.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| AS588_RS03935 (AS588_03935) | comGF | 782619..783014 (+) | 396 | WP_015388004.1 | competence type IV pilus minor pilin ComGF | - |
| AS588_RS03940 (AS588_03940) | comGG | 783015..783392 (+) | 378 | WP_015388005.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| AS588_RS03945 (AS588_03945) | - | 783449..783628 (+) | 180 | WP_003153093.1 | YqzE family protein | - |
| AS588_RS03950 (AS588_03950) | - | 783668..783997 (-) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| AS588_RS03955 (AS588_03955) | tapA | 784257..784928 (+) | 672 | WP_015388007.1 | amyloid fiber anchoring/assembly protein TapA | - |
| AS588_RS03960 (AS588_03960) | sipW | 784900..785484 (+) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| AS588_RS03965 (AS588_03965) | tasA | 785548..786333 (+) | 786 | WP_015388008.1 | biofilm matrix protein TasA | - |
| AS588_RS03970 (AS588_03970) | sinR | 786381..786716 (-) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| AS588_RS03975 (AS588_03975) | sinI | 786750..786923 (-) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| AS588_RS03980 (AS588_03980) | - | 787100..787894 (-) | 795 | WP_014305407.1 | YqhG family protein | - |
| AS588_RS03985 (AS588_03985) | - | 787912..789582 (-) | 1671 | WP_003153107.1 | DEAD/DEAH box helicase | - |
| AS588_RS03990 (AS588_03990) | gcvT | 790005..791105 (+) | 1101 | WP_015388009.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=173410 AS588_RS03975 WP_003153105.1 786750..786923(-) (sinI) [Bacillus amyloliquefaciens strain S499]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=173410 AS588_RS03975 WP_003153105.1 786750..786923(-) (sinI) [Bacillus amyloliquefaciens strain S499]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |