Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   AWV81_RS16310 Genome accession   NZ_CP014471
Coordinates   3034012..3034152 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. natto strain CGMCC 2108     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3029012..3039152
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AWV81_RS16285 (AWV81_16275) yuxO 3029289..3029669 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  AWV81_RS16290 (AWV81_16280) comA 3029688..3030332 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  AWV81_RS16295 (AWV81_16285) comP 3030413..3032725 (-) 2313 WP_014480703.1 sensor histidine kinase Regulator
  AWV81_RS16300 (AWV81_16290) comX 3032741..3032962 (-) 222 WP_014480704.1 competence pheromone ComX -
  AWV81_RS16305 (AWV81_16295) - 3032964..3033827 (-) 864 WP_014480705.1 polyprenyl synthetase family protein -
  AWV81_RS16310 (AWV81_16300) degQ 3034012..3034152 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  AWV81_RS23205 - 3034374..3034499 (+) 126 WP_003228793.1 hypothetical protein -
  AWV81_RS16315 (AWV81_16305) - 3034613..3034981 (+) 369 WP_014477834.1 hypothetical protein -
  AWV81_RS16320 (AWV81_16310) pdeH 3034957..3036186 (-) 1230 WP_014480707.1 cyclic di-GMP phosphodiesterase -
  AWV81_RS16325 (AWV81_16315) pncB 3036322..3037794 (-) 1473 WP_014480708.1 nicotinate phosphoribosyltransferase -
  AWV81_RS16330 (AWV81_16320) pncA 3037810..3038361 (-) 552 WP_014480709.1 isochorismatase family cysteine hydrolase -
  AWV81_RS16335 (AWV81_16325) yueI 3038458..3038856 (-) 399 WP_014480710.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=171750 AWV81_RS16310 WP_003220708.1 3034012..3034152(-) (degQ) [Bacillus subtilis subsp. natto strain CGMCC 2108]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=171750 AWV81_RS16310 WP_003220708.1 3034012..3034152(-) (degQ) [Bacillus subtilis subsp. natto strain CGMCC 2108]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment