Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | AYM37_RS11430 | Genome accession | NZ_CP014444 |
| Coordinates | 2163013..2163483 (-) | Length | 156 a.a. |
| NCBI ID | WP_050961221.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain USA300-SUR24 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2133314..2189261 | 2163013..2163483 | within | 0 |
Gene organization within MGE regions
Location: 2133314..2189261
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AYM37_RS11200 (AYM37_10915) | scn | 2133314..2133664 (-) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| AYM37_RS11205 (AYM37_10920) | - | 2134349..2134798 (+) | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| AYM37_RS15990 (AYM37_10925) | - | 2134893..2135228 (-) | 336 | Protein_2082 | SH3 domain-containing protein | - |
| AYM37_RS11230 (AYM37_10930) | sak | 2135878..2136368 (-) | 491 | Protein_2083 | staphylokinase | - |
| AYM37_RS11235 (AYM37_10935) | - | 2136559..2137314 (-) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| AYM37_RS11240 (AYM37_10940) | - | 2137326..2137580 (-) | 255 | WP_000611512.1 | phage holin | - |
| AYM37_RS11245 (AYM37_10945) | - | 2137632..2137739 (+) | 108 | WP_001791821.1 | hypothetical protein | - |
| AYM37_RS11250 | pepG1 | 2137792..2137926 (-) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| AYM37_RS11255 (AYM37_10950) | - | 2138118..2138414 (-) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| AYM37_RS11260 (AYM37_10955) | - | 2138472..2138759 (-) | 288 | WP_001040261.1 | hypothetical protein | - |
| AYM37_RS11265 (AYM37_10960) | - | 2138806..2138958 (-) | 153 | WP_001153681.1 | hypothetical protein | - |
| AYM37_RS11270 (AYM37_10965) | - | 2138948..2142733 (-) | 3786 | WP_000582165.1 | phage tail spike protein | - |
| AYM37_RS11275 (AYM37_10970) | - | 2142749..2144233 (-) | 1485 | WP_000567394.1 | phage tail domain-containing protein | - |
| AYM37_RS11280 (AYM37_10975) | - | 2144230..2148759 (-) | 4530 | WP_001549166.1 | phage tail tape measure protein | - |
| AYM37_RS16260 | - | 2148816..2148953 (-) | 138 | WP_001549167.1 | hypothetical protein | - |
| AYM37_RS11285 (AYM37_10980) | - | 2149004..2149354 (-) | 351 | WP_001096354.1 | hypothetical protein | - |
| AYM37_RS11290 | - | 2149404..2149643 (-) | 240 | WP_094969769.1 | Ig-like domain-containing protein | - |
| AYM37_RS11295 (AYM37_10985) | - | 2149670..2150314 (-) | 645 | WP_000260578.1 | major tail protein | - |
| AYM37_RS11300 (AYM37_10990) | - | 2150318..2150722 (-) | 405 | WP_000565500.1 | hypothetical protein | - |
| AYM37_RS11305 (AYM37_10995) | - | 2150719..2151123 (-) | 405 | WP_000114229.1 | HK97 gp10 family phage protein | - |
| AYM37_RS11310 (AYM37_11000) | - | 2151120..2151482 (-) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| AYM37_RS11315 (AYM37_11005) | - | 2151466..2151750 (-) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| AYM37_RS11320 (AYM37_11010) | - | 2151740..2152024 (-) | 285 | WP_000238236.1 | hypothetical protein | - |
| AYM37_RS11325 (AYM37_11015) | - | 2152044..2153189 (-) | 1146 | WP_000154559.1 | phage major capsid protein | - |
| AYM37_RS11330 (AYM37_11020) | - | 2153213..2153950 (-) | 738 | WP_000642728.1 | head maturation protease, ClpP-related | - |
| AYM37_RS11335 (AYM37_11025) | - | 2153934..2155121 (-) | 1188 | WP_000025274.1 | phage portal protein | - |
| AYM37_RS11340 (AYM37_11030) | - | 2155137..2156798 (-) | 1662 | WP_000625088.1 | terminase large subunit | - |
| AYM37_RS11345 (AYM37_11035) | - | 2156795..2157139 (-) | 345 | WP_000402904.1 | hypothetical protein | - |
| AYM37_RS11350 (AYM37_11040) | - | 2157269..2157568 (-) | 300 | WP_000988336.1 | HNH endonuclease | - |
| AYM37_RS11355 (AYM37_11045) | - | 2157800..2158216 (-) | 417 | WP_000590122.1 | hypothetical protein | - |
| AYM37_RS11360 (AYM37_11050) | - | 2158244..2158444 (-) | 201 | WP_000265043.1 | DUF1514 family protein | - |
| AYM37_RS11365 (AYM37_11055) | - | 2158444..2158593 (-) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| AYM37_RS11370 (AYM37_11060) | - | 2158590..2158976 (-) | 387 | WP_000592207.1 | hypothetical protein | - |
| AYM37_RS11375 (AYM37_11065) | - | 2158973..2159179 (-) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| AYM37_RS11380 (AYM37_11070) | - | 2159176..2159421 (-) | 246 | WP_001282074.1 | hypothetical protein | - |
| AYM37_RS11385 (AYM37_11075) | - | 2159458..2159991 (-) | 534 | WP_000181819.1 | dUTP pyrophosphatase | - |
| AYM37_RS11390 (AYM37_11080) | - | 2159984..2160226 (-) | 243 | WP_000700108.1 | hypothetical protein | - |
| AYM37_RS11395 (AYM37_11085) | - | 2160216..2160452 (-) | 237 | WP_001065101.1 | DUF1024 family protein | - |
| AYM37_RS11400 (AYM37_11090) | - | 2160445..2160816 (-) | 372 | WP_001549172.1 | hypothetical protein | - |
| AYM37_RS11405 (AYM37_11095) | - | 2160825..2161067 (-) | 243 | WP_000131383.1 | phi PVL orf 51-like protein | - |
| AYM37_RS11410 (AYM37_11100) | - | 2161071..2161439 (-) | 369 | WP_000101288.1 | SA1788 family PVL leukocidin-associated protein | - |
| AYM37_RS11415 (AYM37_11105) | - | 2161452..2161856 (-) | 405 | WP_000401977.1 | RusA family crossover junction endodeoxyribonuclease | - |
| AYM37_RS11420 (AYM37_11110) | - | 2161865..2162083 (-) | 219 | WP_000338530.1 | hypothetical protein | - |
| AYM37_RS11425 (AYM37_11115) | - | 2162090..2162983 (-) | 894 | WP_000148333.1 | DnaD domain-containing protein | - |
| AYM37_RS11430 (AYM37_11120) | ssbA | 2163013..2163483 (-) | 471 | WP_050961221.1 | single-stranded DNA-binding protein | Machinery gene |
| AYM37_RS11435 (AYM37_11125) | - | 2163484..2164101 (-) | 618 | WP_071665632.1 | MBL fold metallo-hydrolase | - |
| AYM37_RS11440 (AYM37_11130) | - | 2164182..2165102 (-) | 921 | WP_000138475.1 | recombinase RecT | - |
| AYM37_RS11445 (AYM37_11135) | - | 2165104..2167047 (-) | 1944 | WP_000700561.1 | AAA family ATPase | - |
| AYM37_RS11450 | - | 2167056..2167319 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| AYM37_RS11455 (AYM37_11140) | - | 2167328..2167588 (-) | 261 | WP_000291513.1 | DUF1108 family protein | - |
| AYM37_RS11460 (AYM37_11145) | - | 2167569..2167888 (-) | 320 | Protein_2130 | DUF2482 family protein | - |
| AYM37_RS11465 (AYM37_11150) | - | 2167983..2168144 (-) | 162 | WP_001285960.1 | DUF1270 domain-containing protein | - |
| AYM37_RS11470 (AYM37_11155) | - | 2168141..2168461 (-) | 321 | WP_001120199.1 | DUF771 domain-containing protein | - |
| AYM37_RS11475 (AYM37_11160) | - | 2168520..2168750 (+) | 231 | WP_000549548.1 | hypothetical protein | - |
| AYM37_RS16170 | - | 2168747..2168923 (-) | 177 | WP_001001356.1 | hypothetical protein | - |
| AYM37_RS11480 (AYM37_11165) | - | 2168939..2169691 (-) | 753 | WP_001148642.1 | phage antirepressor KilAC domain-containing protein | - |
| AYM37_RS11485 (AYM37_11170) | - | 2169742..2170071 (+) | 330 | WP_000180411.1 | hypothetical protein | - |
| AYM37_RS11490 (AYM37_11175) | - | 2170060..2170275 (-) | 216 | WP_001025404.1 | MW1434 family type I TA system toxin | - |
| AYM37_RS11495 (AYM37_11180) | - | 2170291..2170554 (-) | 264 | WP_000854072.1 | helix-turn-helix transcriptional regulator | - |
| AYM37_RS11500 (AYM37_11185) | - | 2170551..2170724 (-) | 174 | WP_001801500.1 | hypothetical protein | - |
| AYM37_RS11505 (AYM37_11190) | - | 2170687..2171400 (+) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| AYM37_RS11510 (AYM37_11195) | - | 2171416..2172348 (+) | 933 | WP_000759682.1 | exonuclease domain-containing protein | - |
| AYM37_RS11515 (AYM37_11200) | - | 2172354..2172695 (+) | 342 | WP_000591749.1 | hypothetical protein | - |
| AYM37_RS11520 (AYM37_11205) | - | 2172899..2173081 (+) | 183 | WP_000705246.1 | hypothetical protein | - |
| AYM37_RS11525 (AYM37_11210) | - | 2173159..2173872 (+) | 714 | WP_001549185.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| AYM37_RS11530 (AYM37_11215) | - | 2174063..2175100 (+) | 1038 | WP_000857199.1 | site-specific integrase | - |
| AYM37_RS11535 (AYM37_11220) | sph | 2175151..2175981 (+) | 831 | Protein_2146 | sphingomyelin phosphodiesterase | - |
| AYM37_RS11540 (AYM37_11225) | lukG | 2176219..2177235 (-) | 1017 | WP_000595324.1 | bi-component leukocidin LukGH subunit G | - |
| AYM37_RS11545 (AYM37_11230) | lukH | 2177257..2178312 (-) | 1056 | WP_000791407.1 | bi-component leukocidin LukGH subunit H | - |
| AYM37_RS11550 (AYM37_11235) | - | 2178747..2179970 (+) | 1224 | WP_000206639.1 | ArgE/DapE family deacylase | - |
| AYM37_RS11560 (AYM37_11240) | - | 2180342..2181187 (-) | 846 | WP_000812010.1 | class I SAM-dependent methyltransferase | - |
| AYM37_RS11565 (AYM37_11245) | - | 2181249..2182160 (-) | 912 | WP_000825510.1 | iron-hydroxamate ABC transporter substrate-binding protein | - |
| AYM37_RS11570 (AYM37_11250) | - | 2182321..2183628 (+) | 1308 | WP_001045079.1 | TrkH family potassium uptake protein | - |
| AYM37_RS11580 (AYM37_11255) | - | 2184481..2184924 (-) | 444 | WP_000022887.1 | GNAT family N-acetyltransferase | - |
| AYM37_RS11585 (AYM37_11260) | - | 2185030..2185466 (-) | 437 | Protein_2154 | hypothetical protein | - |
| AYM37_RS11590 (AYM37_11265) | - | 2185784..2186374 (-) | 591 | WP_001293058.1 | terminase small subunit | - |
| AYM37_RS11595 (AYM37_11270) | - | 2186371..2186583 (-) | 213 | WP_000128898.1 | hypothetical protein | - |
| AYM37_RS11600 | - | 2186644..2187190 (+) | 547 | Protein_2157 | site-specific integrase | - |
| AYM37_RS11605 (AYM37_11280) | groL | 2187285..2188901 (-) | 1617 | WP_000240645.1 | chaperonin GroEL | - |
| AYM37_RS11610 (AYM37_11285) | groES | 2188977..2189261 (-) | 285 | WP_000917289.1 | co-chaperone GroES | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17625.52 Da Isoelectric Point: 4.9432
>NTDB_id=171670 AYM37_RS11430 WP_050961221.1 2163013..2163483(-) (ssbA) [Staphylococcus aureus strain USA300-SUR24]
MLNRTILVGRLTRDPELRTTQNGVNVASFTLAVNRTFTNAQGELEADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MLNRTILVGRLTRDPELRTTQNGVNVASFTLAVNRTFTNAQGELEADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=171670 AYM37_RS11430 WP_050961221.1 2163013..2163483(-) (ssbA) [Staphylococcus aureus strain USA300-SUR24]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAATGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCTCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAATGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCTCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
49.412 |
100 |
0.538 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.768 |
100 |
0.372 |
| ssb | Neisseria meningitidis MC58 |
32.948 |
100 |
0.365 |
| ssb | Neisseria gonorrhoeae MS11 |
32.948 |
100 |
0.365 |