Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | AYM13_RS09755 | Genome accession | NZ_CP014362 |
| Coordinates | 1908107..1908535 (-) | Length | 142 a.a. |
| NCBI ID | WP_031764158.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain USA300-SUR1 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1873494..1917089 | 1908107..1908535 | within | 0 |
Gene organization within MGE regions
Location: 1873494..1917089
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AYM13_RS09515 (AYM13_09295) | - | 1873494..1874939 (-) | 1446 | WP_050961201.1 | SH3 domain-containing protein | - |
| AYM13_RS09520 (AYM13_09300) | - | 1874920..1875357 (-) | 438 | WP_000354119.1 | phage holin | - |
| AYM13_RS09525 (AYM13_09305) | - | 1875413..1875808 (-) | 396 | WP_031890882.1 | hypothetical protein | - |
| AYM13_RS09530 (AYM13_09310) | - | 1875814..1877052 (-) | 1239 | WP_031890881.1 | BppU family phage baseplate upper protein | - |
| AYM13_RS09535 (AYM13_09315) | - | 1877065..1878963 (-) | 1899 | WP_050961200.1 | glucosaminidase domain-containing protein | - |
| AYM13_RS09540 (AYM13_09320) | - | 1879100..1879400 (-) | 301 | Protein_1801 | DUF2951 domain-containing protein | - |
| AYM13_RS09545 (AYM13_09325) | - | 1879440..1879613 (-) | 174 | WP_000782200.1 | XkdX family protein | - |
| AYM13_RS09550 (AYM13_09330) | - | 1879617..1879994 (-) | 378 | WP_031844790.1 | DUF2977 domain-containing protein | - |
| AYM13_RS09555 (AYM13_09335) | - | 1879994..1881817 (-) | 1824 | WP_050961199.1 | phage baseplate upper protein | - |
| AYM13_RS09560 (AYM13_09340) | - | 1881817..1883727 (-) | 1911 | WP_050961198.1 | hypothetical protein | - |
| AYM13_RS09565 (AYM13_09345) | - | 1883742..1885643 (-) | 1902 | WP_000156414.1 | SGNH/GDSL hydrolase family protein | - |
| AYM13_RS09570 (AYM13_09350) | - | 1885652..1886599 (-) | 948 | WP_031898192.1 | phage tail family protein | - |
| AYM13_RS09575 (AYM13_09355) | - | 1886612..1890079 (-) | 3468 | WP_050961197.1 | hypothetical protein | - |
| AYM13_RS09580 (AYM13_09360) | - | 1890096..1890440 (-) | 345 | WP_001599101.1 | hypothetical protein | - |
| AYM13_RS09585 (AYM13_09365) | - | 1890470..1890835 (-) | 366 | WP_031898197.1 | tail assembly chaperone | - |
| AYM13_RS09590 (AYM13_09370) | - | 1890897..1891478 (-) | 582 | WP_031898198.1 | phage major tail protein, TP901-1 family | - |
| AYM13_RS09595 (AYM13_09375) | - | 1891497..1891880 (-) | 384 | WP_000188640.1 | hypothetical protein | - |
| AYM13_RS09600 (AYM13_09380) | - | 1891892..1892239 (-) | 348 | WP_001017815.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| AYM13_RS09605 (AYM13_09385) | - | 1892239..1892541 (-) | 303 | WP_031880723.1 | hypothetical protein | - |
| AYM13_RS09610 (AYM13_09390) | - | 1892538..1892870 (-) | 333 | WP_000208959.1 | phage head-tail connector protein | - |
| AYM13_RS09615 (AYM13_09395) | - | 1892879..1893166 (-) | 288 | WP_001114085.1 | hypothetical protein | - |
| AYM13_RS09620 (AYM13_09400) | - | 1893188..1894162 (-) | 975 | WP_000438500.1 | phage major capsid protein | - |
| AYM13_RS09625 (AYM13_09405) | - | 1894176..1894796 (-) | 621 | WP_031925652.1 | DUF4355 domain-containing protein | - |
| AYM13_RS15810 | - | 1894784..1894901 (-) | 118 | Protein_1819 | hypothetical protein | - |
| AYM13_RS15700 (AYM13_09410) | - | 1894905..1895054 (-) | 150 | WP_031898218.1 | hypothetical protein | - |
| AYM13_RS09630 (AYM13_09415) | - | 1895127..1896122 (-) | 996 | WP_001813737.1 | minor capsid protein | - |
| AYM13_RS09635 (AYM13_09420) | - | 1896129..1897664 (-) | 1536 | WP_000921887.1 | phage portal protein | - |
| AYM13_RS09640 (AYM13_09425) | - | 1897675..1898952 (-) | 1278 | WP_000169945.1 | PBSX family phage terminase large subunit | - |
| AYM13_RS09645 (AYM13_09430) | - | 1898939..1899379 (-) | 441 | WP_001003271.1 | terminase small subunit | - |
| AYM13_RS09650 (AYM13_09435) | - | 1899566..1899985 (-) | 420 | WP_000058632.1 | transcriptional regulator | - |
| AYM13_RS09655 (AYM13_09440) | - | 1900000..1900146 (-) | 147 | WP_000990005.1 | hypothetical protein | - |
| AYM13_RS09660 (AYM13_09445) | - | 1900147..1900320 (-) | 174 | WP_031924097.1 | transcriptional activator RinB | - |
| AYM13_RS09665 (AYM13_09450) | - | 1900317..1900523 (-) | 207 | WP_031764620.1 | DUF1381 domain-containing protein | - |
| AYM13_RS09670 (AYM13_09455) | - | 1900560..1901066 (-) | 507 | WP_076035554.1 | dUTPase | - |
| AYM13_RS15705 | - | 1901081..1901242 (-) | 162 | WP_000889682.1 | hypothetical protein | - |
| AYM13_RS09675 (AYM13_09460) | - | 1901243..1901524 (-) | 282 | WP_000454994.1 | hypothetical protein | - |
| AYM13_RS15710 | - | 1901525..1901698 (-) | 174 | WP_000028424.1 | hypothetical protein | - |
| AYM13_RS09680 (AYM13_09465) | - | 1901688..1901939 (-) | 252 | WP_076035555.1 | DUF1024 family protein | - |
| AYM13_RS09685 (AYM13_09470) | - | 1901932..1902321 (-) | 390 | WP_033861700.1 | hypothetical protein | - |
| AYM13_RS09690 (AYM13_09475) | - | 1902318..1902665 (-) | 348 | WP_000979209.1 | YopX family protein | - |
| AYM13_RS09695 (AYM13_09480) | - | 1902665..1902856 (-) | 192 | WP_076035556.1 | hypothetical protein | - |
| AYM13_RS09700 (AYM13_09485) | - | 1902853..1903233 (-) | 381 | WP_076035557.1 | hypothetical protein | - |
| AYM13_RS09705 (AYM13_09490) | - | 1903247..1903495 (-) | 249 | WP_076035558.1 | phi PVL orf 51-like protein | - |
| AYM13_RS09710 (AYM13_09495) | - | 1903496..1904005 (-) | 510 | WP_076035559.1 | SA1788 family PVL leukocidin-associated protein | - |
| AYM13_RS09715 (AYM13_09500) | - | 1904006..1904191 (-) | 186 | WP_072512743.1 | DUF3113 family protein | - |
| AYM13_RS09720 (AYM13_09505) | - | 1904196..1904600 (-) | 405 | WP_076035560.1 | DUF1064 domain-containing protein | - |
| AYM13_RS09725 (AYM13_09510) | - | 1904611..1904832 (-) | 222 | WP_001123685.1 | DUF3269 family protein | - |
| AYM13_RS09730 (AYM13_09515) | - | 1904835..1905050 (-) | 216 | WP_001024406.1 | hypothetical protein | - |
| AYM13_RS09735 (AYM13_09520) | - | 1905047..1906288 (-) | 1242 | WP_001106169.1 | DnaB helicase C-terminal domain-containing protein | - |
| AYM13_RS09740 (AYM13_09525) | - | 1906285..1906641 (-) | 357 | WP_031764163.1 | hypothetical protein | - |
| AYM13_RS09745 (AYM13_09530) | - | 1906641..1907426 (-) | 786 | WP_076035561.1 | phage replisome organizer N-terminal domain-containing protein | - |
| AYM13_RS09750 (AYM13_09535) | - | 1907398..1908093 (-) | 696 | WP_031764159.1 | putative HNHc nuclease | - |
| AYM13_RS09755 (AYM13_09540) | ssbA | 1908107..1908535 (-) | 429 | WP_031764158.1 | single-stranded DNA-binding protein | Machinery gene |
| AYM13_RS09760 (AYM13_09545) | - | 1908535..1909173 (-) | 639 | WP_001043062.1 | ERF family protein | - |
| AYM13_RS09765 (AYM13_09550) | - | 1909173..1909652 (-) | 480 | WP_000002512.1 | siphovirus Gp157 family protein | - |
| AYM13_RS09770 (AYM13_09555) | - | 1909645..1909881 (-) | 237 | WP_000848127.1 | hypothetical protein | - |
| AYM13_RS09775 (AYM13_09560) | - | 1909889..1910149 (-) | 261 | WP_000291100.1 | DUF1108 family protein | - |
| AYM13_RS09780 (AYM13_09565) | - | 1910243..1910404 (-) | 162 | WP_000048124.1 | DUF1270 family protein | - |
| AYM13_RS09785 (AYM13_09570) | - | 1910397..1910618 (-) | 222 | WP_000977381.1 | hypothetical protein | - |
| AYM13_RS09790 (AYM13_09575) | - | 1910689..1911354 (+) | 666 | WP_031764600.1 | hypothetical protein | - |
| AYM13_RS15815 | - | 1911375..1911443 (-) | 69 | Protein_1856 | hypothetical protein | - |
| AYM13_RS09795 (AYM13_09580) | - | 1911459..1912208 (-) | 750 | WP_001148587.1 | phage antirepressor KilAC domain-containing protein | - |
| AYM13_RS09800 (AYM13_09585) | - | 1912210..1912395 (-) | 186 | WP_000933365.1 | helix-turn-helix transcriptional regulator | - |
| AYM13_RS15870 | - | 1912838..1912972 (+) | 135 | WP_001119050.1 | hypothetical protein | - |
| AYM13_RS09805 (AYM13_09590) | - | 1912969..1913172 (-) | 204 | WP_031764597.1 | hypothetical protein | - |
| AYM13_RS09810 (AYM13_09595) | - | 1913186..1913422 (-) | 237 | WP_001121116.1 | helix-turn-helix transcriptional regulator | - |
| AYM13_RS09815 (AYM13_09600) | - | 1913574..1913888 (+) | 315 | WP_000333630.1 | helix-turn-helix transcriptional regulator | - |
| AYM13_RS09820 (AYM13_09605) | - | 1913901..1914362 (+) | 462 | WP_031764593.1 | toxin | - |
| AYM13_RS09825 (AYM13_09610) | - | 1914380..1914883 (+) | 504 | WP_031764591.1 | hypothetical protein | - |
| AYM13_RS09830 (AYM13_09615) | - | 1914945..1915994 (+) | 1050 | WP_031764589.1 | tyrosine-type recombinase/integrase | - |
| AYM13_RS09835 (AYM13_09620) | - | 1916070..1917089 (-) | 1020 | Protein_1866 | SasC/FmtB family protein | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 15958.67 Da Isoelectric Point: 7.0144
>NTDB_id=170702 AYM13_RS09755 WP_031764158.1 1908107..1908535(-) (ssbA) [Staphylococcus aureus strain USA300-SUR1]
MLNRVVLVGRLTKDPELRSAPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYENKVGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTDNNPFDNTTAITDDDLPF
MLNRVVLVGRLTKDPELRSAPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYENKVGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTDNNPFDNTTAITDDDLPF
Nucleotide
Download Length: 429 bp
>NTDB_id=170702 AYM13_RS09755 WP_031764158.1 1908107..1908535(-) (ssbA) [Staphylococcus aureus strain USA300-SUR1]
ATGTTAAACAGAGTAGTTTTAGTAGGACGCTTAACAAAAGACCCAGAATTAAGAAGCGCGCCAAATGGCGTAAATGTAGG
TACATTCACATTGGCAGTAAACAGAACATTCACGAATGCTCAAGGCGAACGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAGAAACAAGCTGAAAATGTTAAAAACTACCTTTCTAAAGGGTCGCTGGCAGGTGTAGACGGGCGACTACAAACACGT
AGCTACGAAAATAAAGTCGGGCAACGTGTATTTGTGACAGAAGTAGTAGCAGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGATAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
ATGTTAAACAGAGTAGTTTTAGTAGGACGCTTAACAAAAGACCCAGAATTAAGAAGCGCGCCAAATGGCGTAAATGTAGG
TACATTCACATTGGCAGTAAACAGAACATTCACGAATGCTCAAGGCGAACGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAGAAACAAGCTGAAAATGTTAAAAACTACCTTTCTAAAGGGTCGCTGGCAGGTGTAGACGGGCGACTACAAACACGT
AGCTACGAAAATAAAGTCGGGCAACGTGTATTTGTGACAGAAGTAGTAGCAGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGATAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
58.721 |
100 |
0.711 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.606 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
74.648 |
0.444 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
42.657 |
100 |
0.43 |
| ssbA | Streptococcus mutans UA159 |
41.549 |
100 |
0.415 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
45.763 |
83.099 |
0.38 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
45.763 |
83.099 |
0.38 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
44.915 |
83.099 |
0.373 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
44.915 |
83.099 |
0.373 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
44.915 |
83.099 |
0.373 |
| ssbB/cilA | Streptococcus mitis SK321 |
44.915 |
83.099 |
0.373 |