Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   BKN48_RS01740 Genome accession   NZ_CP017676
Coordinates   295436..295609 (+) Length   57 a.a.
NCBI ID   WP_014477323.1    Uniprot ID   -
Organism   Bacillus subtilis strain VV2     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 290436..300609
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BKN48_RS01725 (BKN48_01725) gcvT 291234..292322 (-) 1089 WP_038829737.1 glycine cleavage system aminomethyltransferase GcvT -
  BKN48_RS01730 (BKN48_01730) hepAA 292764..294437 (+) 1674 WP_038829735.1 DEAD/DEAH box helicase -
  BKN48_RS01735 (BKN48_01735) yqhG 294458..295252 (+) 795 WP_032726154.1 YqhG family protein -
  BKN48_RS01740 (BKN48_01740) sinI 295436..295609 (+) 174 WP_014477323.1 anti-repressor SinI Regulator
  BKN48_RS01745 (BKN48_01745) sinR 295643..295978 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  BKN48_RS01750 (BKN48_01750) tasA 296070..296855 (-) 786 WP_014477324.1 biofilm matrix protein TasA -
  BKN48_RS01755 (BKN48_01755) sipW 296920..297492 (-) 573 WP_080481282.1 signal peptidase I SipW -
  BKN48_RS01760 (BKN48_01760) tapA 297476..298237 (-) 762 WP_070547528.1 amyloid fiber anchoring/assembly protein TapA -
  BKN48_RS01765 (BKN48_01765) yqzG 298508..298834 (+) 327 WP_021480018.1 YqzG/YhdC family protein -
  BKN48_RS01770 (BKN48_01770) spoIITA 298876..299055 (-) 180 WP_014480252.1 YqzE family protein -
  BKN48_RS01775 (BKN48_01775) comGG 299127..299501 (-) 375 WP_064671036.1 ComG operon protein ComGG Machinery gene
  BKN48_RS01780 (BKN48_01780) comGF 299502..299885 (-) 384 WP_070547529.1 ComG operon protein ComGF Machinery gene
  BKN48_RS01785 (BKN48_01785) comGE 299911..300258 (-) 348 WP_070547530.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6633.58 Da        Isoelectric Point: 6.7231

>NTDB_id=170569 BKN48_RS01740 WP_014477323.1 295436..295609(+) (sinI) [Bacillus subtilis strain VV2]
MKNAKQEHFELDQEWVELMMEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=170569 BKN48_RS01740 WP_014477323.1 295436..295609(+) (sinI) [Bacillus subtilis strain VV2]
ATGAAAAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTGATGATGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

98.246

100

0.982