Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | AXW78_RS12510 | Genome accession | NZ_CP014282 |
| Coordinates | 2494176..2494454 (+) | Length | 92 a.a. |
| NCBI ID | WP_061884209.1 | Uniprot ID | A0A9W3YKH5 |
| Organism | Bacillus thuringiensis strain Bt185 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2485870..2527854 | 2494176..2494454 | within | 0 |
Gene organization within MGE regions
Location: 2485870..2527854
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AXW78_RS12460 (AXW78_12460) | - | 2485870..2486133 (+) | 264 | WP_002082716.1 | DUF3937 domain-containing protein | - |
| AXW78_RS33835 | - | 2486482..2486616 (+) | 135 | Protein_2443 | site-specific integrase | - |
| AXW78_RS12465 (AXW78_12465) | - | 2486824..2487309 (+) | 486 | WP_002164034.1 | hypothetical protein | - |
| AXW78_RS12470 (AXW78_12470) | - | 2487619..2488320 (+) | 702 | WP_061884202.1 | DUF3962 domain-containing protein | - |
| AXW78_RS12475 (AXW78_12475) | - | 2488358..2489467 (-) | 1110 | WP_061884203.1 | tyrosine-type recombinase/integrase | - |
| AXW78_RS12480 (AXW78_12480) | - | 2490065..2491273 (+) | 1209 | WP_061884204.1 | AimR family lysis-lysogeny pheromone receptor | - |
| AXW78_RS34390 | - | 2491300..2491455 (+) | 156 | WP_165375022.1 | hypothetical protein | - |
| AXW78_RS12490 (AXW78_12490) | - | 2491719..2492069 (-) | 351 | WP_061884206.1 | helix-turn-helix transcriptional regulator | - |
| AXW78_RS12495 (AXW78_12495) | - | 2492249..2492473 (+) | 225 | WP_061884207.1 | helix-turn-helix transcriptional regulator | - |
| AXW78_RS12500 (AXW78_12500) | - | 2492514..2492780 (+) | 267 | WP_000522182.1 | helix-turn-helix domain-containing protein | - |
| AXW78_RS34395 | - | 2492780..2492935 (+) | 156 | WP_081113949.1 | hypothetical protein | - |
| AXW78_RS12505 (AXW78_12505) | - | 2493156..2494172 (+) | 1017 | WP_061884208.1 | DnaD domain protein | - |
| AXW78_RS12510 (AXW78_12510) | abrB | 2494176..2494454 (+) | 279 | WP_061884209.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| AXW78_RS12515 (AXW78_12515) | - | 2494447..2494806 (+) | 360 | WP_061884210.1 | hypothetical protein | - |
| AXW78_RS32210 | - | 2494825..2494992 (+) | 168 | WP_000754942.1 | DUF3954 domain-containing protein | - |
| AXW78_RS12520 (AXW78_12520) | - | 2495018..2495269 (+) | 252 | WP_061884211.1 | hypothetical protein | - |
| AXW78_RS12525 (AXW78_12525) | - | 2495290..2495772 (+) | 483 | WP_061884212.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| AXW78_RS12530 (AXW78_12530) | - | 2495886..2496749 (-) | 864 | WP_061884213.1 | hypothetical protein | - |
| AXW78_RS35270 | - | 2497487..2497735 (-) | 249 | Protein_2460 | exosporium leader peptide-containing protein | - |
| AXW78_RS12540 (AXW78_12540) | - | 2498418..2498981 (-) | 564 | WP_231122444.1 | complement C1q domain-containing protein | - |
| AXW78_RS12545 (AXW78_12545) | - | 2500234..2501559 (+) | 1326 | WP_061884215.1 | exosporium glycoprotein BclB-related protein | - |
| AXW78_RS12550 (AXW78_12550) | - | 2501878..2502132 (+) | 255 | WP_061884216.1 | hypothetical protein | - |
| AXW78_RS12555 (AXW78_12555) | - | 2502314..2502778 (-) | 465 | WP_001109248.1 | hypothetical protein | - |
| AXW78_RS12560 (AXW78_12560) | - | 2502970..2503701 (-) | 732 | WP_061884217.1 | hypothetical protein | - |
| AXW78_RS12565 (AXW78_12565) | - | 2505267..2505449 (+) | 183 | WP_061884218.1 | hypothetical protein | - |
| AXW78_RS34400 | - | 2505578..2505748 (+) | 171 | WP_000866143.1 | hypothetical protein | - |
| AXW78_RS12570 (AXW78_12570) | - | 2505769..2506239 (+) | 471 | WP_061884219.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| AXW78_RS12575 (AXW78_12575) | - | 2506236..2506778 (+) | 543 | WP_061884220.1 | tyrosine-type recombinase/integrase | - |
| AXW78_RS12580 (AXW78_12580) | - | 2507410..2507622 (+) | 213 | WP_000453545.1 | DNA translocase FtsK | - |
| AXW78_RS12585 (AXW78_12585) | - | 2507663..2507860 (+) | 198 | WP_001054638.1 | hypothetical protein | - |
| AXW78_RS12590 (AXW78_12590) | - | 2507908..2508132 (+) | 225 | WP_000422427.1 | hypothetical protein | - |
| AXW78_RS12600 (AXW78_12600) | - | 2508324..2508569 (+) | 246 | WP_000676190.1 | hypothetical protein | - |
| AXW78_RS34405 (AXW78_12605) | - | 2508608..2508877 (+) | 270 | WP_002164449.1 | HNH endonuclease signature motif containing protein | - |
| AXW78_RS12610 (AXW78_12610) | - | 2508880..2509188 (+) | 309 | WP_000587659.1 | hypothetical protein | - |
| AXW78_RS12615 (AXW78_12615) | - | 2509297..2509617 (+) | 321 | WP_001170969.1 | P27 family phage terminase small subunit | - |
| AXW78_RS12620 (AXW78_12620) | - | 2509601..2511280 (+) | 1680 | WP_000178388.1 | terminase TerL endonuclease subunit | - |
| AXW78_RS12625 (AXW78_12625) | - | 2511295..2512467 (+) | 1173 | WP_061884221.1 | phage portal protein | - |
| AXW78_RS12630 (AXW78_12630) | - | 2512448..2513164 (+) | 717 | WP_061884222.1 | head maturation protease, ClpP-related | - |
| AXW78_RS12635 (AXW78_12635) | - | 2513207..2514370 (+) | 1164 | WP_046946241.1 | phage major capsid protein | - |
| AXW78_RS12640 (AXW78_12640) | - | 2514511..2514798 (+) | 288 | WP_033693053.1 | hypothetical protein | - |
| AXW78_RS12645 (AXW78_12645) | - | 2514788..2515144 (+) | 357 | WP_061884223.1 | phage head closure protein | - |
| AXW78_RS12650 (AXW78_12650) | - | 2515137..2515538 (+) | 402 | WP_021727580.1 | hypothetical protein | - |
| AXW78_RS12655 (AXW78_12655) | - | 2515525..2515953 (+) | 429 | WP_081113953.1 | hypothetical protein | - |
| AXW78_RS12660 (AXW78_12660) | - | 2515954..2516538 (+) | 585 | WP_021727578.1 | major tail protein B | - |
| AXW78_RS12665 (AXW78_12665) | - | 2516610..2517071 (+) | 462 | WP_000867964.1 | hypothetical protein | - |
| AXW78_RS12670 (AXW78_12670) | - | 2517250..2519082 (+) | 1833 | WP_061884224.1 | hypothetical protein | - |
| AXW78_RS12675 (AXW78_12675) | - | 2519300..2522140 (+) | 2841 | WP_231122445.1 | hypothetical protein | - |
| AXW78_RS12680 (AXW78_12680) | - | 2522142..2522825 (+) | 684 | WP_061884225.1 | phage tail domain-containing protein | - |
| AXW78_RS12685 (AXW78_12685) | - | 2522825..2525230 (+) | 2406 | WP_061884226.1 | phage tail spike protein | - |
| AXW78_RS12690 (AXW78_12690) | - | 2525245..2526426 (+) | 1182 | WP_061884227.1 | BppU family phage baseplate upper protein | - |
| AXW78_RS12695 (AXW78_12695) | - | 2526507..2526746 (+) | 240 | WP_061884228.1 | hemolysin XhlA family protein | - |
| AXW78_RS12700 (AXW78_12700) | - | 2526789..2527019 (+) | 231 | WP_000792698.1 | phage holin | - |
| AXW78_RS12705 (AXW78_12705) | - | 2527036..2527854 (+) | 819 | WP_061884229.1 | GH25 family lysozyme | - |
Sequence
Protein
Download Length: 92 a.a. Molecular weight: 10211.89 Da Isoelectric Point: 5.1799
>NTDB_id=170190 AXW78_RS12510 WP_061884209.1 2494176..2494454(+) (abrB) [Bacillus thuringiensis strain Bt185]
MKNIGVARKVEELGRVVIPVELRRTLGIVEGTALDFHVEGENIVLRKYEKSCFVTGEVSETNIELLDGRMFLSKEGAIEL
LDLIQKSGMAHA
MKNIGVARKVEELGRVVIPVELRRTLGIVEGTALDFHVEGENIVLRKYEKSCFVTGEVSETNIELLDGRMFLSKEGAIEL
LDLIQKSGMAHA
Nucleotide
Download Length: 279 bp
>NTDB_id=170190 AXW78_RS12510 WP_061884209.1 2494176..2494454(+) (abrB) [Bacillus thuringiensis strain Bt185]
ATGAAAAACATAGGTGTTGCAAGAAAAGTGGAAGAGCTAGGTCGTGTAGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
GATTGTCGAAGGTACGGCACTAGATTTTCATGTTGAGGGTGAAAACATTGTTCTAAGAAAATATGAAAAGTCATGCTTTG
TAACGGGTGAAGTTTCTGAAACCAACATAGAGTTGCTAGATGGGCGAATGTTTTTAAGCAAGGAAGGGGCAATTGAATTA
CTGGATCTTATTCAGAAGAGTGGGATGGCACATGCCTAA
ATGAAAAACATAGGTGTTGCAAGAAAAGTGGAAGAGCTAGGTCGTGTAGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
GATTGTCGAAGGTACGGCACTAGATTTTCATGTTGAGGGTGAAAACATTGTTCTAAGAAAATATGAAAAGTCATGCTTTG
TAACGGGTGAAGTTTCTGAAACCAACATAGAGTTGCTAGATGGGCGAATGTTTTTAAGCAAGGAAGGGGCAATTGAATTA
CTGGATCTTATTCAGAAGAGTGGGATGGCACATGCCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
56.322 |
94.565 |
0.533 |