Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGC   Type   Machinery gene
Locus tag   AUL54_RS18310 Genome accession   NZ_CP013950
Coordinates   3726963..3727229 (+) Length   88 a.a.
NCBI ID   WP_045926801.1    Uniprot ID   -
Organism   Bacillus sp. SDLI1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 3721963..3732229
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AUL54_RS18290 (AUL54_18300) - 3722232..3723533 (-) 1302 WP_060964762.1 hemolysin family protein -
  AUL54_RS18295 (AUL54_18305) - 3723679..3724629 (+) 951 WP_060964763.1 magnesium transporter CorA family protein -
  AUL54_RS18300 (AUL54_18310) comGA 3724822..3725892 (+) 1071 WP_045926720.1 competence type IV pilus ATPase ComGA Machinery gene
  AUL54_RS18305 (AUL54_18315) comGB 3725879..3726916 (+) 1038 WP_060964764.1 competence type IV pilus assembly protein ComGB Machinery gene
  AUL54_RS18310 (AUL54_18320) comGC 3726963..3727229 (+) 267 WP_045926801.1 competence type IV pilus major pilin ComGC Machinery gene
  AUL54_RS18315 (AUL54_18325) comGD 3727219..3727656 (+) 438 WP_060964765.1 competence type IV pilus minor pilin ComGD Machinery gene
  AUL54_RS18320 (AUL54_18330) comGE 3727640..3727954 (+) 315 WP_060964766.1 competence type IV pilus minor pilin ComGE Machinery gene
  AUL54_RS18325 (AUL54_18335) comGF 3727866..3728363 (+) 498 WP_235588382.1 competence type IV pilus minor pilin ComGF -
  AUL54_RS18330 (AUL54_18340) comGG 3728364..3728741 (+) 378 WP_060964768.1 competence type IV pilus minor pilin ComGG Machinery gene
  AUL54_RS18335 (AUL54_18345) - 3728798..3728977 (+) 180 WP_022552966.1 YqzE family protein -
  AUL54_RS18340 (AUL54_18350) - 3729018..3729347 (-) 330 WP_016938972.1 DUF3889 domain-containing protein -
  AUL54_RS18345 (AUL54_18355) tapA 3729606..3730277 (+) 672 WP_060964769.1 amyloid fiber anchoring/assembly protein TapA -
  AUL54_RS18350 (AUL54_18360) - 3730249..3730833 (+) 585 WP_060964770.1 signal peptidase I -
  AUL54_RS18355 (AUL54_18365) - 3730897..3731682 (+) 786 WP_016938976.1 TasA family protein -
  AUL54_RS18360 (AUL54_18370) sinR 3731730..3732065 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator

Sequence


Protein


Download         Length: 88 a.a.        Molecular weight: 9735.39 Da        Isoelectric Point: 6.7057

>NTDB_id=166505 AUL54_RS18310 WP_045926801.1 3726963..3727229(+) (comGC) [Bacillus sp. SDLI1]
MLIVLFIVSILLLITIPNVTKHNQSIQHKGCEGLQNMVKAQVTAYEIDHEGKMPDMKDLQSEGYIKKNTACPNGKQILIS
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=166505 AUL54_RS18310 WP_045926801.1 3726963..3727229(+) (comGC) [Bacillus sp. SDLI1]
ATGCTGATCGTGTTATTTATCGTTTCAATTCTGCTTTTAATAACGATTCCTAACGTTACAAAACATAATCAAAGCATACA
GCATAAAGGCTGTGAAGGACTGCAGAATATGGTGAAAGCCCAAGTGACGGCGTACGAAATCGACCATGAAGGAAAAATGC
CGGATATGAAAGACTTACAATCAGAGGGATATATCAAAAAGAATACAGCCTGTCCGAATGGAAAACAGATCTTAATTAGC
GGCGGGGAAGTTACAGTTGAACAATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

74.648

80.682

0.602


Multiple sequence alignment