Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   AUL54_RS15300 Genome accession   NZ_CP013950
Coordinates   3149110..3149250 (+) Length   46 a.a.
NCBI ID   WP_013353398.1    Uniprot ID   P06532
Organism   Bacillus sp. SDLI1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3144110..3154250
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AUL54_RS15275 (AUL54_15285) - 3144423..3144821 (+) 399 WP_060964418.1 DUF1694 domain-containing protein -
  AUL54_RS15280 (AUL54_15290) - 3144910..3145461 (+) 552 WP_060964419.1 isochorismatase family cysteine hydrolase -
  AUL54_RS15285 (AUL54_15295) - 3145479..3146945 (+) 1467 WP_101605399.1 nicotinate phosphoribosyltransferase -
  AUL54_RS15290 (AUL54_15300) - 3147075..3148298 (+) 1224 WP_060964420.1 EAL and HDOD domain-containing protein -
  AUL54_RS15295 (AUL54_15305) - 3148303..3148644 (-) 342 WP_060964421.1 hypothetical protein -
  AUL54_RS15300 (AUL54_15310) degQ 3149110..3149250 (+) 141 WP_013353398.1 degradation enzyme regulation protein DegQ Regulator
  AUL54_RS15305 (AUL54_15315) - 3149402..3150277 (+) 876 WP_060965112.1 polyprenyl synthetase family protein -
  AUL54_RS15310 (AUL54_15320) comX 3150292..3150468 (+) 177 WP_044052947.1 competence pheromone ComX -
  AUL54_RS15315 (AUL54_15325) comP 3150487..3152793 (+) 2307 WP_060964422.1 sensor histidine kinase Regulator
  AUL54_RS15320 (AUL54_15330) comA 3152874..3153518 (+) 645 WP_016938117.1 response regulator transcription factor Regulator
  AUL54_RS15325 (AUL54_15335) - 3153540..3153923 (+) 384 WP_060964423.1 hotdog fold thioesterase -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5532.37 Da        Isoelectric Point: 6.2567

>NTDB_id=166488 AUL54_RS15300 WP_013353398.1 3149110..3149250(+) (degQ) [Bacillus sp. SDLI1]
MEKKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=166488 AUL54_RS15300 WP_013353398.1 3149110..3149250(+) (degQ) [Bacillus sp. SDLI1]
GTGGAAAAGAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCTTTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB P06532

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

91.304

100

0.913


Multiple sequence alignment