Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   BSHJ0_RS17230 Genome accession   NZ_CP016894
Coordinates   3263506..3263646 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain HJ0-6     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3258506..3268646
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSHJ0_RS17205 (BSHJ0_03386) yuxO 3258782..3259162 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  BSHJ0_RS17210 (BSHJ0_03387) comA 3259181..3259825 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  BSHJ0_RS17215 (BSHJ0_03388) comP 3259906..3262218 (-) 2313 WP_068947635.1 histidine kinase Regulator
  BSHJ0_RS17220 (BSHJ0_03389) comX 3262234..3262455 (-) 222 WP_014114983.1 competence pheromone ComX -
  BSHJ0_RS17225 (BSHJ0_03390) comQ 3262452..3263321 (-) 870 WP_015714626.1 polyprenyl synthetase family protein Regulator
  BSHJ0_RS17230 (BSHJ0_03391) degQ 3263506..3263646 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  BSHJ0_RS22935 - 3263868..3263993 (+) 126 WP_121549029.1 hypothetical protein -
  BSHJ0_RS17235 (BSHJ0_03392) - 3264108..3264476 (+) 369 WP_038427878.1 hypothetical protein -
  BSHJ0_RS17240 (BSHJ0_03393) pdeH 3264452..3265681 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  BSHJ0_RS17245 (BSHJ0_03394) pncB 3265818..3267290 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  BSHJ0_RS17250 (BSHJ0_03395) pncA 3267306..3267857 (-) 552 WP_014477836.1 cysteine hydrolase family protein -
  BSHJ0_RS17255 (BSHJ0_03396) yueI 3267954..3268352 (-) 399 WP_015251331.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=165212 BSHJ0_RS17230 WP_003220708.1 3263506..3263646(-) (degQ) [Bacillus subtilis strain HJ0-6]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=165212 BSHJ0_RS17230 WP_003220708.1 3263506..3263646(-) (degQ) [Bacillus subtilis strain HJ0-6]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1