Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   BSHJ0_RS13310 Genome accession   NZ_CP016894
Coordinates   2543914..2544087 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis strain HJ0-6     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2538914..2549087
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSHJ0_RS13295 (BSHJ0_02615) gcvT 2539714..2540802 (-) 1089 WP_015714248.1 glycine cleavage system aminomethyltransferase GcvT -
  BSHJ0_RS13300 (BSHJ0_02616) hepAA 2541243..2542916 (+) 1674 WP_029726726.1 DEAD/DEAH box helicase -
  BSHJ0_RS13305 (BSHJ0_02617) yqhG 2542937..2543731 (+) 795 WP_015714249.1 YqhG family protein -
  BSHJ0_RS13310 (BSHJ0_02618) sinI 2543914..2544087 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  BSHJ0_RS13315 (BSHJ0_02619) sinR 2544121..2544456 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  BSHJ0_RS13320 (BSHJ0_02620) tasA 2544549..2545334 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  BSHJ0_RS13325 (BSHJ0_02621) sipW 2545398..2545970 (-) 573 WP_072692741.1 signal peptidase I SipW -
  BSHJ0_RS13330 (BSHJ0_02622) tapA 2545954..2546715 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  BSHJ0_RS13335 (BSHJ0_02623) yqzG 2546986..2547312 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  BSHJ0_RS13340 (BSHJ0_02624) spoIITA 2547354..2547533 (-) 180 WP_029726723.1 YqzE family protein -
  BSHJ0_RS13345 (BSHJ0_02625) comGG 2547605..2547979 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  BSHJ0_RS13350 (BSHJ0_02626) comGF 2547980..2548363 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  BSHJ0_RS13355 (BSHJ0_02627) comGE 2548389..2548736 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=165176 BSHJ0_RS13310 WP_003230187.1 2543914..2544087(+) (sinI) [Bacillus subtilis strain HJ0-6]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=165176 BSHJ0_RS13310 WP_003230187.1 2543914..2544087(+) (sinI) [Bacillus subtilis strain HJ0-6]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment