Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | A7Q05_RS07190 | Genome accession | NZ_CP016863 |
| Coordinates | 1293759..1294070 (+) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | A0A0H2XGS7 |
| Organism | Staphylococcus aureus strain 1625.C01 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1288759..1299070
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A7Q05_RS07160 (A7Q05_1265) | - | 1289542..1289745 (+) | 204 | WP_000087561.1 | YqgQ family protein | - |
| A7Q05_RS07165 (A7Q05_1266) | - | 1289742..1290728 (+) | 987 | WP_000161314.1 | ROK family glucokinase | - |
| A7Q05_RS07170 (A7Q05_1267) | - | 1290728..1291057 (+) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| A7Q05_RS07175 (A7Q05_1268) | - | 1291054..1291677 (+) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| A7Q05_RS07180 (A7Q05_1269) | comGA | 1291729..1292703 (+) | 975 | WP_000697228.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| A7Q05_RS07185 (A7Q05_1270) | comGB | 1292675..1293745 (+) | 1071 | WP_000775708.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| A7Q05_RS07190 (A7Q05_1271) | comGC | 1293759..1294070 (+) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| A7Q05_RS07195 (A7Q05_1272) | comGD | 1294048..1294494 (+) | 447 | WP_001791635.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| A7Q05_RS07200 (A7Q05_1273) | comGE | 1294481..1294780 (+) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| A7Q05_RS07205 (A7Q05_1274) | comGF | 1294698..1295195 (+) | 498 | WP_001789864.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| A7Q05_RS07210 (A7Q05_04115) | - | 1295292..1295438 (+) | 147 | WP_001789879.1 | hypothetical protein | - |
| A7Q05_RS07215 (A7Q05_1275) | - | 1295428..1295952 (+) | 525 | WP_001015117.1 | shikimate kinase | - |
| A7Q05_RS07220 (A7Q05_1276) | gcvT | 1296111..1297202 (+) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| A7Q05_RS07225 (A7Q05_1277) | gcvPA | 1297222..1298568 (+) | 1347 | WP_000019687.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=164541 A7Q05_RS07190 WP_000472256.1 1293759..1294070(+) (comGC) [Staphylococcus aureus strain 1625.C01]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=164541 A7Q05_RS07190 WP_000472256.1 1293759..1294070(+) (comGC) [Staphylococcus aureus strain 1625.C01]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comGC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comGC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |