Detailed information NTG0163555

Bioinformatically predicted

Overview

• Name: pilC
• Type: Machinery gene
• Locus tag: A6L50_RS15555
• Genome accession: NZ_CP016680
• Coordinates: 1254991..1255113 (+)
• Length: 40 a.a.
• NCBI ID: WP_335582226.1
• Uniprot ID: -
• Organism: Neisseria meningitidis strain M22822
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1249991..1260113

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
A6L50_RS06545 (A6L50_06545)	hpaC	1250360..1250860 (-)	501	WP_002233027.1	4-hydroxyphenylacetate 3-monooxygenase, reductase component	-
A6L50_RS06550 (A6L50_06550)	nadR	1250975..1251415 (-)	441	WP_002221507.1	MarR family adhesin repressor NadR	-
A6L50_RS06560 (A6L50_06560)	-	1251758..1252267 (-)	510	WP_002240006.1	protein disulfide oxidoreductase	-
A6L50_RS06570 (A6L50_06570)	apbC	1252632..1253711 (+)	1080	WP_002239302.1	iron-sulfur cluster carrier protein ApbC	-
A6L50_RS15555	pilC	1254991..1255113 (+)	123	WP_335582226.1	hypothetical protein	Machinery gene
A6L50_RS06575 (A6L50_06575)	pilC	1255110..1258079 (+)	2970	WP_025464225.1	PilC family type IV pilus tip adhesin	Machinery gene

Sequence

Protein

• Length: 40 a.a.
• Molecular weight: 4570.45 Da
• Isoelectric Point: 12.8111

>NTDB_id=163555 A6L50_RS15555 WP_335582226.1 1254991..1255113(+) (pilC) [Neisseria meningitidis strain M22822]
MNKTLKRRVFRHTALYAAILMFSHTGGGGRRRKPINTLLS

Nucleotide

• Length: 123 bp

>NTDB_id=163555 A6L50_RS15555 WP_335582226.1 1254991..1255113(+) (pilC) [Neisseria meningitidis strain M22822]
ATGAATAAAACTTTAAAAAGGCGGGTTTTCCGCCATACCGCGCTTTATGCCGCCATCTTGATGTTTTCCCATACCGGCGG
GGGGGGGCGCAGGCGCAAACCCATCAATACGCTATTATCATGA

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilC	Neisseria meningitidis A1493	96.552	72.5	0.7