Detailed information    

insolico Bioinformatically predicted

Overview


Name   sxy/tfoX   Type   Regulator
Locus tag   FORC29_RS17655 Genome accession   NZ_CP013185
Coordinates   3308026..3308655 (-) Length   209 a.a.
NCBI ID   WP_000839153.1    Uniprot ID   A0A9Q6Y251
Organism   Escherichia coli strain FORC_029     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3296948..3334341 3308026..3308655 within 0


Gene organization within MGE regions


Location: 3296948..3334341
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FORC29_RS17595 (FORC29_3176) - 3296948..3297967 (+) 1020 WP_001367167.1 tyrosine-type recombinase/integrase -
  FORC29_RS17600 (FORC29_3178) yccA 3298375..3299034 (+) 660 WP_000375136.1 FtsH protease modulator YccA -
  FORC29_RS17605 (FORC29_3179) tusE 3299125..3299454 (+) 330 WP_000904442.1 sulfurtransferase TusE -
  FORC29_RS17610 (FORC29_3180) yccX 3299451..3299729 (-) 279 WP_000048243.1 acylphosphatase -
  FORC29_RS17615 (FORC29_3181) rlmI 3299824..3301014 (+) 1191 WP_000116288.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  FORC29_RS17620 (FORC29_3182) hspQ 3301072..3301389 (+) 318 WP_001295356.1 heat shock protein HspQ -
  FORC29_RS17625 (FORC29_3183) yccU 3301434..3301847 (-) 414 WP_000665217.1 CoA-binding protein -
  FORC29_RS17630 (FORC29_3184) csgI 3302020..3302682 (+) 663 WP_000847785.1 DUF2057 family protein -
  FORC29_RS17635 (FORC29_3185) mgsA 3302778..3303236 (+) 459 WP_001386685.1 methylglyoxal synthase -
  FORC29_RS17640 (FORC29_3186) helD 3303268..3305322 (-) 2055 WP_000420536.1 DNA helicase IV -
  FORC29_RS17645 (FORC29_3187) yccF 3305445..3305891 (+) 447 WP_001261231.1 YccF domain-containing protein -
  FORC29_RS17650 (FORC29_3188) yccS 3305901..3308063 (+) 2163 WP_000875044.1 YccS family putative transporter -
  FORC29_RS17655 (FORC29_3189) sxy/tfoX 3308026..3308655 (-) 630 WP_000839153.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  FORC29_RS17660 (FORC29_3190) sulA 3308874..3309383 (+) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  FORC29_RS17670 (FORC29_3191) ompA 3309740..3310780 (+) 1041 WP_000750416.1 porin OmpA -
  FORC29_RS17675 (FORC29_3192) matP 3310856..3311308 (-) 453 WP_000877161.1 macrodomain Ter protein MatP -
  FORC29_RS17680 (FORC29_3193) ycbZ 3311494..3313254 (+) 1761 WP_000156526.1 AAA family ATPase -
  FORC29_RS17685 (FORC29_3194) fabA 3313323..3313841 (+) 519 WP_001386684.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  FORC29_RS17690 rmf 3313911..3314078 (-) 168 WP_000828648.1 ribosome modulation factor -
  FORC29_RS17695 (FORC29_3195) pqiC 3314334..3314897 (-) 564 WP_000759123.1 membrane integrity-associated transporter subunit PqiC -
  FORC29_RS17700 (FORC29_3196) pqiB 3314894..3316534 (-) 1641 WP_000445533.1 intermembrane transport protein PqiB -
  FORC29_RS17705 (FORC29_3197) pqiA 3316539..3317792 (-) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  FORC29_RS17710 (FORC29_3198) uup 3317922..3319829 (-) 1908 WP_000053089.1 ABC transporter ATP-binding protein -
  FORC29_RS17715 (FORC29_3199) rlmKL 3319840..3321948 (-) 2109 WP_001086517.1 bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL -
  FORC29_RS17720 (FORC29_3200) ycbX 3322192..3323301 (+) 1110 WP_000258204.1 6-N-hydroxylaminopurine resistance protein YcbX -
  FORC29_RS17725 (FORC29_3201) zapC 3323298..3323840 (-) 543 WP_001295353.1 cell division protein ZapC -
  FORC29_RS17730 (FORC29_3202) pyrD 3324014..3325024 (-) 1011 WP_001295352.1 quinone-dependent dihydroorotate dehydrogenase -
  FORC29_RS17735 (FORC29_3203) ycbF 3325135..3325872 (-) 738 WP_001111470.1 fimbrial chaperone -
  FORC29_RS17740 (FORC29_3204) ycbV 3325838..3326353 (-) 516 WP_000919489.1 fimbrial protein -
  FORC29_RS17745 (FORC29_3205) ycbU 3326361..3326903 (-) 543 WP_000730614.1 fimbrial protein -
  FORC29_RS17750 (FORC29_3206) elfG 3326915..3327985 (-) 1071 WP_001165657.1 fimbrial protein -
  FORC29_RS17755 (FORC29_3207) - 3327976..3330024 (-) 2049 Protein_3276 fimbrial biogenesis usher protein -
  FORC29_RS17760 (FORC29_3208) - 3330277..3330807 (-) 531 WP_000077538.1 hypothetical protein -
  FORC29_RS17765 - 3330997..3331245 (+) 249 WP_001310454.1 helix-turn-helix domain-containing protein -
  FORC29_RS17770 (FORC29_3209) - 3331247..3333337 (+) 2091 WP_000289277.1 Mu transposase C-terminal domain-containing protein -
  FORC29_RS17775 (FORC29_3210) - 3333409..3334341 (+) 933 WP_000129797.1 AAA family ATPase -

Sequence


Protein


Download         Length: 209 a.a.        Molecular weight: 24147.02 Da        Isoelectric Point: 9.2180

>NTDB_id=160488 FORC29_RS17655 WP_000839153.1 3308026..3308655(-) (sxy/tfoX) [Escherichia coli strain FORC_029]
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=160488 FORC29_RS17655 WP_000839153.1 3308026..3308655(-) (sxy/tfoX) [Escherichia coli strain FORC_029]
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

100

100

1


Multiple sequence alignment