Detailed information    

insolico Bioinformatically predicted

Overview

Name   nucA/comI   Type   Machinery gene
Locus tag   AQ983_RS20445 Genome accession   NZ_CP013018
Coordinates   840598..840735 (+) Length   45 a.a.
NCBI ID   WP_155760351.1    Uniprot ID   -
Organism   Clostridium pasteurianum DSM 525 = ATCC 6013     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Genomic Context

Location: 835598..845735
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AQ983_RS21165 (AQ983_03660) - 835692..836171 (+) 480 WP_257786242.1 RHS repeat-associated core domain-containing protein -
  AQ983_RS03680 (AQ983_03665) - 836197..836526 (+) 330 WP_003441125.1 transposase -
  AQ983_RS03685 (AQ983_03670) - 836571..837452 (+) 882 WP_003441126.1 IS3 family transposase -
  AQ983_RS03690 (AQ983_03675) - 837565..838011 (+) 447 WP_003446350.1 DUF2691 family protein -
  AQ983_RS03695 (AQ983_03680) - 837980..838327 (+) 348 WP_003446349.1 hypothetical protein -
  AQ983_RS03700 (AQ983_03685) - 838589..839494 (+) 906 WP_003446348.1 RHS repeat-associated core domain-containing protein -
  AQ983_RS03705 (AQ983_03690) - 839535..839888 (+) 354 WP_236900378.1 immunity 53 family protein -
  AQ983_RS03710 (AQ983_03695) - 840048..840392 (+) 345 WP_003446346.1 hypothetical protein -
  AQ983_RS20445 nucA/comI 840598..840735 (+) 138 WP_155760351.1 hypothetical protein Machinery gene
  AQ983_RS03715 (AQ983_03700) - 840762..841409 (+) 648 WP_003446344.1 DUF2625 family protein -
  AQ983_RS03720 (AQ983_03705) - 841757..842611 (+) 855 WP_003446342.1 hypothetical protein -
  AQ983_RS03725 (AQ983_03710) - 842708..843481 (+) 774 WP_003446340.1 hypothetical protein -
  AQ983_RS21595 - 843641..844063 (+) 423 WP_003446338.1 DUF4351 domain-containing protein -
  AQ983_RS03735 (AQ983_03720) - 844281..845099 (+) 819 WP_003446336.1 alpha/beta fold hydrolase -
  AQ983_RS03740 (AQ983_03725) - 845432..845713 (+) 282 WP_003446334.1 hypothetical protein -

Sequence

Protein


Download         Length: 45 a.a.        Molecular weight: 4772.49 Da        Isoelectric Point: 12.2333

>NTDB_id=159269 AQ983_RS20445 WP_155760351.1 840598..840735(+) (nucA/comI) [Clostridium pasteurianum DSM 525 = ATCC 6013]
MFRKGGMGASVRPFSPSDNRGAGSALGHKLRAFPDGTRVRIKIGD

Nucleotide


Download         Length: 138 bp        

>NTDB_id=159269 AQ983_RS20445 WP_155760351.1 840598..840735(+) (nucA/comI) [Clostridium pasteurianum DSM 525 = ATCC 6013]
ATGTTTAGAAAAGGTGGAATGGGAGCGAGTGTAAGACCATTTTCACCTTCTGATAATAGAGGAGCTGGTTCTGCATTAGG
TCATAAATTAAGAGCATTCCCAGATGGAACAAGAGTAAGAATTAAAATTGGTGATTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

58.14

95.556

0.556

Multiple sequence alignment