Detailed information    

insolico Bioinformatically predicted

Overview


Name   recU   Type   Machinery gene
Locus tag   AMR71_RS09375 Genome accession   NZ_CP012482
Coordinates   1826201..1826836 (-) Length   211 a.a.
NCBI ID   WP_057079360.1    Uniprot ID   -
Organism   Bacillus altitudinis strain NJ-V2     
Function   plasmid transformation; homologous recombination (predicted from homology)   
Homologous recombination

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1821568..1875374 1826201..1826836 within 0


Gene organization within MGE regions


Location: 1821568..1875374
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AMR71_RS09355 (AMR71_09355) - 1821568..1822272 (+) 705 WP_046343833.1 DnaD domain-containing protein -
  AMR71_RS09360 (AMR71_09360) nth 1822290..1822952 (+) 663 WP_057079358.1 endonuclease III -
  AMR71_RS09365 (AMR71_09365) - 1822949..1823458 (+) 510 WP_025207533.1 YpoC family protein -
  AMR71_RS09370 (AMR71_09370) - 1823494..1826181 (-) 2688 WP_057079359.1 PBP1A family penicillin-binding protein -
  AMR71_RS09375 (AMR71_09375) recU 1826201..1826836 (-) 636 WP_057079360.1 Holliday junction resolvase RecU Machinery gene
  AMR71_RS09380 (AMR71_09380) - 1826883..1827839 (+) 957 WP_017359732.1 DUF2515 domain-containing protein -
  AMR71_RS09385 (AMR71_09385) sspM 1827863..1827967 (-) 105 WP_017359731.1 acid-soluble spore protein SspM -
  AMR71_RS09390 (AMR71_09390) - 1828161..1828397 (+) 237 WP_008344612.1 DUF5446 family protein -
  AMR71_RS09395 (AMR71_09395) - 1828447..1828827 (+) 381 WP_225310452.1 YppE family protein -
  AMR71_RS09400 (AMR71_09400) - 1828936..1829388 (+) 453 WP_017359729.1 YppG family protein -
  AMR71_RS09405 (AMR71_09405) - 1829410..1829829 (-) 420 WP_007500867.1 Hsp20/alpha crystallin family protein -
  AMR71_RS09410 (AMR71_09410) - 1829998..1830504 (+) 507 WP_008344623.1 PTS sugar transporter subunit IIA -
  AMR71_RS09415 (AMR71_09415) - 1830554..1831672 (-) 1119 WP_234780998.1 NADH-dependent flavin oxidoreductase -
  AMR71_RS09420 (AMR71_09420) - 1831833..1833641 (+) 1809 Protein_1876 DEAD/DEAH box helicase -
  AMR71_RS09425 (AMR71_09425) - 1833671..1835470 (-) 1800 WP_057079362.1 recombinase family protein -
  AMR71_RS09430 - 1835514..1835915 (-) 402 WP_057079363.1 helix-turn-helix domain-containing protein -
  AMR71_RS09435 (AMR71_09435) - 1836080..1836289 (+) 210 WP_057095059.1 helix-turn-helix transcriptional regulator -
  AMR71_RS09440 (AMR71_09440) - 1836339..1836542 (+) 204 WP_057079365.1 hypothetical protein -
  AMR71_RS09445 (AMR71_09445) - 1836798..1837076 (+) 279 WP_057079366.1 YqaH family protein -
  AMR71_RS09450 (AMR71_09450) - 1837140..1837580 (+) 441 WP_057079367.1 hypothetical protein -
  AMR71_RS09455 (AMR71_09455) - 1837577..1838749 (+) 1173 WP_057079368.1 DUF2800 domain-containing protein -
  AMR71_RS09460 (AMR71_09460) - 1838871..1839617 (+) 747 WP_057079369.1 DUF2815 family protein -
  AMR71_RS09465 (AMR71_09465) - 1839617..1841596 (+) 1980 WP_205627798.1 DNA polymerase -
  AMR71_RS09470 (AMR71_09470) - 1841754..1842143 (+) 390 WP_057079371.1 hypothetical protein -
  AMR71_RS09475 (AMR71_09475) - 1842148..1842567 (+) 420 WP_234780999.1 hypothetical protein -
  AMR71_RS09480 (AMR71_09480) - 1842564..1842785 (+) 222 WP_057079373.1 hypothetical protein -
  AMR71_RS09485 (AMR71_09485) - 1842805..1845225 (+) 2421 WP_057079374.1 virulence-associated E family protein -
  AMR71_RS09490 (AMR71_09490) - 1845518..1845814 (+) 297 WP_057079375.1 VRR-NUC domain-containing protein -
  AMR71_RS09495 (AMR71_09495) - 1845811..1847193 (+) 1383 WP_057079376.1 DEAD/DEAH box helicase -
  AMR71_RS09500 (AMR71_09500) - 1847190..1847702 (+) 513 WP_057079377.1 hypothetical protein -
  AMR71_RS09505 (AMR71_09505) - 1847847..1848107 (+) 261 WP_057079378.1 hypothetical protein -
  AMR71_RS19485 (AMR71_09510) - 1848174..1848530 (+) 357 WP_057079379.1 HNH endonuclease -
  AMR71_RS09510 (AMR71_09515) - 1848523..1848843 (+) 321 WP_081038962.1 transglycosylase -
  AMR71_RS09515 (AMR71_09520) - 1848930..1849433 (+) 504 WP_057079380.1 phage terminase small subunit P27 family -
  AMR71_RS09520 (AMR71_09525) - 1849433..1851145 (+) 1713 WP_057079381.1 terminase large subunit -
  AMR71_RS20155 (AMR71_09530) - 1851159..1851341 (+) 183 WP_057079382.1 hypothetical protein -
  AMR71_RS09530 (AMR71_09535) - 1851347..1852588 (+) 1242 WP_057079383.1 phage portal protein -
  AMR71_RS09535 (AMR71_09540) - 1852581..1853213 (+) 633 WP_057079384.1 HK97 family phage prohead protease -
  AMR71_RS09540 (AMR71_09545) - 1853249..1854430 (+) 1182 WP_057079385.1 phage major capsid protein -
  AMR71_RS09545 (AMR71_09550) - 1854441..1854740 (+) 300 WP_057079386.1 hypothetical protein -
  AMR71_RS09550 (AMR71_09555) - 1854765..1855166 (+) 402 WP_017367773.1 collagen-like triple helix repeat-containing protein -
  AMR71_RS09555 (AMR71_09560) - 1855181..1855522 (+) 342 WP_057079387.1 head-tail connector protein -
  AMR71_RS09560 (AMR71_09565) - 1855458..1855823 (+) 366 WP_057079388.1 phage head closure protein -
  AMR71_RS09565 (AMR71_09570) - 1855816..1856199 (+) 384 WP_057079389.1 HK97-gp10 family putative phage morphogenesis protein -
  AMR71_RS09570 (AMR71_09575) gp17 1856196..1856564 (+) 369 WP_057079390.1 tail completion protein gp17 -
  AMR71_RS09575 (AMR71_09580) - 1856576..1857202 (+) 627 WP_057079391.1 major tail protein -
  AMR71_RS09580 (AMR71_09585) gpG 1857241..1857576 (+) 336 WP_057079392.1 phage tail assembly chaperone G -
  AMR71_RS09585 (AMR71_09590) - 1857579..1857773 (+) 195 WP_017367766.1 hypothetical protein -
  AMR71_RS09590 (AMR71_09595) - 1857789..1861805 (+) 4017 WP_057079393.1 phage tail tape measure protein -
  AMR71_RS09595 (AMR71_09600) - 1861805..1862638 (+) 834 WP_057079394.1 phage tail domain-containing protein -
  AMR71_RS09600 (AMR71_09605) - 1862651..1864381 (+) 1731 WP_057079395.1 phage tail protein -
  AMR71_RS09605 (AMR71_09610) - 1864411..1866294 (+) 1884 WP_234781000.1 right-handed parallel beta-helix repeat-containing protein -
  AMR71_RS09610 (AMR71_09615) - 1866308..1867666 (+) 1359 WP_057079397.1 phage baseplate upper protein -
  AMR71_RS09615 (AMR71_09620) - 1867684..1867983 (+) 300 WP_057079398.1 hypothetical protein -
  AMR71_RS09620 (AMR71_09625) - 1867980..1868159 (+) 180 WP_057079399.1 XkdX family protein -
  AMR71_RS09625 (AMR71_09630) - 1868202..1868621 (+) 420 WP_057079400.1 phage holin family protein -
  AMR71_RS09630 (AMR71_09635) - 1868667..1869476 (+) 810 WP_057079401.1 N-acetylmuramoyl-L-alanine amidase -
  AMR71_RS09640 - 1869749..1870240 (-) 492 WP_057079402.1 hypothetical protein -
  AMR71_RS09645 (AMR71_09650) - 1870383..1870574 (-) 192 WP_057079403.1 helix-turn-helix domain-containing protein -
  AMR71_RS09650 (AMR71_09655) - 1870828..1871907 (+) 1080 WP_057079404.1 RapH N-terminal domain-containing protein -
  AMR71_RS09655 (AMR71_09660) - 1871928..1872131 (+) 204 WP_057079405.1 hypothetical protein -
  AMR71_RS09660 (AMR71_09665) - 1872262..1872453 (+) 192 WP_123768291.1 hypothetical protein -
  AMR71_RS09665 (AMR71_09670) - 1872502..1872960 (+) 459 Protein_1925 Zn-binding domain-containing protein -
  AMR71_RS09670 (AMR71_09675) - 1872984..1874231 (+) 1248 WP_057079408.1 ribonuclease H-like domain-containing protein -
  AMR71_RS19490 cotD 1874546..1874782 (+) 237 WP_072368252.1 spore coat protein CotD -
  AMR71_RS09675 (AMR71_09680) - 1874832..1875374 (+) 543 WP_202394241.1 DUF1273 domain-containing protein -

Sequence


Protein


Download         Length: 211 a.a.        Molecular weight: 24344.69 Da        Isoelectric Point: 9.6582

>NTDB_id=154653 AMR71_RS09375 WP_057079360.1 1826201..1826836(-) (recU) [Bacillus altitudinis strain NJ-V2]
MIRYPNGKSYQPIQQIGTKKRISGESSYSNRGMMLEADLNETNQYYLVNGIAVIHKKPTPVQIVNVDYPKRSAAVIKEAY
FKQSSTTDYNGVYKGRYIDFEAKETKSTTSFPLKNFHDHQIEHMKQVEKQGGICFVIISAFGSVYYLSATDLFFFWERQQ
QNGRKSISKDELMEAGHLMTLGYSPRIDYIKVVETLHFSDDSKQHLRSKKV

Nucleotide


Download         Length: 636 bp        

>NTDB_id=154653 AMR71_RS09375 WP_057079360.1 1826201..1826836(-) (recU) [Bacillus altitudinis strain NJ-V2]
ATGATTCGGTATCCTAACGGAAAATCGTATCAGCCCATTCAACAAATTGGGACAAAAAAAAGAATCAGCGGCGAATCATC
TTATAGTAACCGCGGGATGATGCTTGAAGCTGACTTAAATGAAACGAACCAGTACTATTTGGTCAACGGGATCGCAGTCA
TTCATAAAAAGCCTACCCCTGTTCAAATTGTCAATGTGGATTATCCAAAAAGAAGCGCTGCTGTCATTAAAGAAGCCTAT
TTTAAACAATCCTCCACAACAGACTACAACGGGGTATACAAAGGGCGTTATATCGATTTTGAAGCAAAGGAAACCAAAAG
CACCACCTCGTTTCCACTCAAAAATTTCCACGACCATCAAATTGAGCATATGAAACAGGTTGAAAAGCAAGGCGGTATTT
GTTTTGTTATTATATCCGCATTTGGTTCCGTTTATTATTTGTCCGCTACTGACCTCTTCTTCTTTTGGGAGCGGCAGCAG
CAAAACGGCCGAAAATCCATTAGCAAAGATGAATTAATGGAAGCAGGTCACCTCATGACACTTGGATATTCGCCAAGAAT
TGATTATATTAAAGTAGTGGAGACACTTCATTTTTCGGATGACAGCAAGCAACATTTACGTTCGAAAAAGGTTTAA

Domains


Predicted by InterproScan.

(31-193)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  recU Bacillus subtilis subsp. subtilis str. 168

72.277

95.735

0.692


Multiple sequence alignment