Detailed information    

experimental Experimentally validated

Overview

Name   recU   Type   Machinery gene
Locus tag   BSU_22310 Genome accession   NC_000964
Coordinates   2340802..2341422 (+) Length   206 a.a.
NCBI ID   NP_390112.1    Uniprot ID   P39792
Organism   Bacillus subtilis subsp. subtilis str. 168     
Function   plasmid transformation; homologous recombination   
Homologous recombination

Function

RecU is involved in the resolution of recombination intermediates and the regulation of RecA activity. It has been shown to enhance RecA-promoted DNA strand invasion and to facilitate the resolution of Holliday junctions (HJs) during DNA recombination. RecU is also involved in the establishment of plasmid DNA within competent cells, where it helps to down-regulate RecA activity, which is crucial for efficient plasmid transformation.


Genomic Context

Location: 2335802..2346422
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSU_22230 (BSU22230) ypqE 2336933..2337439 (-) 507 NP_390105.1 putative phosphotransferase system enzyme IIA component -
  BSU_22240 (BSU22240) ypqA 2337577..2337996 (+) 420 NP_390106.1 putative chaperone -
  BSU_22250 (BSU22250) yppG 2338017..2338394 (-) 378 NP_390107.1 putative spore coat protein; methionine-glutamine-rich protein -
  BSU_22260 (BSU22260) yppF 2338582..2338770 (+) 189 NP_390108.1 putative sporulation protein -
  BSU_22270 (BSU22270) yppE 2338809..2339180 (-) 372 NP_390109.1 hypothetical protein -
  BSU_22280 (BSU22280) yppD 2339226..2339471 (-) 246 NP_390110.1 putative sporulation protein -
  BSU_22290 (BSU22290) sspM 2339670..2339774 (+) 105 YP_054585.1 small acid-soluble spore protein -
  BSU_22300 (BSU22300) yppC 2339799..2340761 (-) 963 NP_390111.1 hypothetical protein -
  BSU_22310 (BSU22310) recU 2340802..2341422 (+) 621 NP_390112.1 Holliday junction resolvase Machinery gene
  BSU_22320 (BSU22320) ponA 2341444..2344188 (+) 2745 NP_390113.1 peptidoglycan glycosyltransferase (penicillin-binding proteins 1A and 1B) -
  BSU_22330 (BSU22330) ypoC 2344264..2344758 (-) 495 NP_390114.1 hypothetical protein -
  BSU_22340 (BSU22340) nth 2344755..2345414 (-) 660 NP_390115.1 endonuclease III, apurinic apyrimidic DNA lyase -
  BSU_22350 (BSU22350) dnaD 2345433..2346131 (-) 699 NP_390116.1 DNA-remodelling primosomal protein -

Sequence

Protein


Download         Length: 206 a.a.        Molecular weight: 23959.09 Da        Isoelectric Point: 9.6240

>NTDB_id=117 BSU_22310 NP_390112.1 2340802..2341422(+) (recU) [Bacillus subtilis subsp. subtilis str. 168]
MIRYPNGKTFQPKHSVSSQNSQKRAPSYSNRGMTLEDDLNETNKYYLTNQIAVIHKKPTPVQIVNVHYPKRSAAVIKEAY
FKQSSTTDYNGIYKGRYIDFEAKETKNKTSFPLQNFHDHQIEHMKQVKAQDGICFVIISAFDQVYFLEADKLFYFWDRKE
KNGRKSIRKDELEETAYPISLGYAPRIDYISIIEQLYFSPSSGAKG

Nucleotide


Download         Length: 621 bp        

>NTDB_id=117 BSU_22310 NP_390112.1 2340802..2341422(+) (recU) [Bacillus subtilis subsp. subtilis str. 168]
GTGATTCGGTATCCTAATGGAAAAACATTTCAGCCGAAACATTCGGTTTCATCCCAAAACAGTCAGAAAAGGGCCCCGTC
TTACAGTAATCGCGGAATGACCCTCGAAGATGACTTAAACGAAACGAATAAGTATTATCTGACAAACCAAATTGCCGTTA
TACACAAAAAGCCGACACCTGTTCAAATTGTAAATGTCCATTATCCAAAAAGAAGTGCCGCAGTGATTAAAGAAGCTTAC
TTTAAACAATCATCGACAACAGACTACAATGGGATTTACAAAGGGCGGTATATTGATTTTGAGGCGAAAGAAACGAAAAA
CAAGACCTCTTTCCCCCTGCAGAATTTTCATGACCATCAAATCGAGCATATGAAGCAGGTAAAGGCTCAAGACGGTATTT
GTTTTGTTATTATATCCGCTTTCGACCAGGTTTATTTTTTGGAAGCCGATAAGCTGTTTTATTTCTGGGACAGAAAAGAA
AAAAACGGCAGAAAATCAATTCGAAAAGATGAGTTGGAAGAAACAGCTTATCCGATTTCTCTTGGATACGCACCCAGAAT
TGATTATATTAGTATTATTGAACAGCTTTATTTTTCGCCATCATCTGGTGCGAAAGGTTGA

Domains

Predicted by InterProScan.

Recombination protein U (RecU)

(31-193)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  PDB 1RZN
  PDB 1ZP7
  PDB 5FDK

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value

References

[1] Carolina Gándara et al. (2021) DisA Restrains the Processing and Cleavage of Reversed Replication Forks by the RuvAB-RecU Resolvasome. International Journal of Molecular Sciences 22(21):11323. [PMID: 34768753]
[2] Ester Serrano et al. (2018) RecA Regulation by RecU and DprA During Bacillus subtilis Natural Plasmid Transformation. Frontiers in Microbiology 9:1514. [PMID: 30050509]
[3] Peter E Burby et al. (2017) MutS2 Promotes Homologous Recombination in Bacillus subtilis. Journal of Bacteriology 199(2):e00682-16. [PMID: 27799325]
[4] Cristina Cañas et al. (2014) Interaction of branch migration translocases with the Holliday junction-resolving enzyme and their implications in Holliday junction resolution. The Journal of Biological Chemistry 289(25):17634-46. [PMID: 24770420]
[5] Cristina Cañas et al. (2011) The stalk region of the RecU resolvase is essential for Holliday junction recognition and distortion. Journal of Molecular Biology 410(1):39-49. [PMID: 21600217]
[6] Begoña Carrasco et al. (2009) The N-terminal region of the RecU holliday junction resolvase is essential for homologous recombination. Journal of Molecular Biology 390(1):1-9. [PMID: 19422832]
[7] Gareth A Cromie (2009) Phylogenetic ubiquity and shuffling of the bacterial RecBCD and AddAB recombination complexes. Journal of Bacteriology 191(16):5076-84. [PMID: 19542287]
[8] Dawit Kidane et al. (2009) Evidence for different pathways during horizontal gene transfer in competent Bacillus subtilis cells. PLoS Genetics 5(9):e1000630. [PMID: 19730681]
[9] Cristina Cañas et al. (2008) The RecU Holliday junction resolvase acts at early stages of homologous recombination. Nucleic Acids Research 36(16):5242-9. [PMID: 18684995]
[10] Humberto Sanchez et al. (2005) The RuvAB branch migration translocase and RecU Holliday junction resolvase are required for double-stranded DNA break repair in Bacillus subtilis. Genetics 171(3):873-83. [PMID: 16020779]
[11] Begoña Carrasco et al. (2005) Bacillus subtilis RecU Holliday-junction resolvase modulates RecA activities. Nucleic Acids Research 33(12):3942-52. [PMID: 16024744]
[12] Silvia Ayora et al. (2004) Bacillus subtilis RecU protein cleaves Holliday junctions and anneals single-stranded DNA. Proceedings of The National Academy of Sciences of The United States of America 101(2):452-7. [PMID: 14701911]
[13] Begoña Carrasco et al. (2004) Genetic recombination in Bacillus subtilis 168: contribution of Holliday junction processing functions in chromosome segregation. Journal of Bacteriology 186(17):5557-66. [PMID: 15317759]