Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   AS891_RS10810 Genome accession   NZ_CP015375
Coordinates   2059596..2059769 (-) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis subsp. subtilis strain KCTC 3135     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2054596..2064769
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AS891_RS10765 (AS891_10760) comGE 2054871..2055218 (+) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  AS891_RS10770 (AS891_10765) comGF 2055244..2055627 (+) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  AS891_RS10775 (AS891_10770) comGG 2055628..2056002 (+) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  AS891_RS10780 (AS891_10775) spoIITA 2056073..2056252 (+) 180 WP_003230176.1 YqzE family protein -
  AS891_RS10785 (AS891_10780) yqzG 2056294..2056620 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  AS891_RS10790 (AS891_10785) tapA 2056892..2057653 (+) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  AS891_RS10795 (AS891_10790) sipW 2057637..2058209 (+) 573 WP_003246088.1 signal peptidase I SipW -
  AS891_RS10800 (AS891_10795) tasA 2058273..2059058 (+) 786 WP_004398632.1 biofilm matrix protein TasA -
  AS891_RS10805 (AS891_10800) sinR 2059151..2059486 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  AS891_RS10810 (AS891_10805) sinI 2059596..2059769 (-) 174 WP_003230187.1 anti-repressor SinI Regulator
  AS891_RS10815 (AS891_10810) yqhG 2059952..2060746 (-) 795 WP_003230200.1 YqhG family protein -
  AS891_RS10820 (AS891_10815) hepAA 2060767..2062440 (-) 1674 WP_004398544.1 DEAD/DEAH box helicase -
  AS891_RS10825 (AS891_10820) gcvT 2062882..2063970 (+) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=153633 AS891_RS10810 WP_003230187.1 2059596..2059769(-) (sinI) [Bacillus subtilis subsp. subtilis strain KCTC 3135]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=153633 AS891_RS10810 WP_003230187.1 2059596..2059769(-) (sinI) [Bacillus subtilis subsp. subtilis strain KCTC 3135]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment