Detailed information
Bioinformatically predicted
Overview
| Name | degQ | Type | Regulator |
| Locus tag | AKO66_RS05005 | Genome accession | NZ_CP012330 |
| Coordinates | 1000449..1000589 (+) | Length | 46 a.a. |
| NCBI ID | WP_003213123.1 | Uniprot ID | A0A5K1N966 |
| Organism | Bacillus altitudinis strain NJ-V | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 995449..1005589
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AKO66_RS04980 (AKO66_04970) | - | 995679..996086 (+) | 408 | WP_007500468.1 | YueI family protein | - |
| AKO66_RS04985 (AKO66_04975) | - | 996147..996698 (+) | 552 | WP_025207909.1 | cysteine hydrolase family protein | - |
| AKO66_RS04990 (AKO66_04980) | - | 996716..998185 (+) | 1470 | WP_007500472.1 | nicotinate phosphoribosyltransferase | - |
| AKO66_RS04995 (AKO66_04985) | - | 998327..999553 (+) | 1227 | WP_017367964.1 | EAL and HDOD domain-containing protein | - |
| AKO66_RS05000 (AKO66_04990) | - | 999590..999943 (-) | 354 | WP_017367963.1 | hypothetical protein | - |
| AKO66_RS05005 (AKO66_04995) | degQ | 1000449..1000589 (+) | 141 | WP_003213123.1 | degradation enzyme regulation protein DegQ | Regulator |
| AKO66_RS05010 (AKO66_05000) | - | 1000741..1001664 (+) | 924 | WP_008345863.1 | polyprenyl synthetase family protein | - |
| AKO66_RS05015 (AKO66_05005) | comX | 1001642..1001812 (+) | 171 | WP_017358941.1 | competence pheromone ComX | - |
| AKO66_RS05020 (AKO66_05010) | comP | 1001826..1004132 (+) | 2307 | WP_017367961.1 | ATP-binding protein | Regulator |
| AKO66_RS05025 (AKO66_05015) | comA | 1004213..1004854 (+) | 642 | WP_007500477.1 | response regulator transcription factor | Regulator |
| AKO66_RS05030 (AKO66_05020) | - | 1004877..1005266 (+) | 390 | WP_017358943.1 | hotdog fold thioesterase | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5677.42 Da Isoelectric Point: 4.6828
>NTDB_id=153487 AKO66_RS05005 WP_003213123.1 1000449..1000589(+) (degQ) [Bacillus altitudinis strain NJ-V]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=153487 AKO66_RS05005 WP_003213123.1 1000449..1000589(+) (degQ) [Bacillus altitudinis strain NJ-V]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAACTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA
ATGGAAAAGTATGAAATCGAAGAACTTAAACAACTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
68.085 |
100 |
0.696 |