Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   AKO66_RS05005 Genome accession   NZ_CP012330
Coordinates   1000449..1000589 (+) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus altitudinis strain NJ-V     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 995449..1005589
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AKO66_RS04980 (AKO66_04970) - 995679..996086 (+) 408 WP_007500468.1 YueI family protein -
  AKO66_RS04985 (AKO66_04975) - 996147..996698 (+) 552 WP_025207909.1 cysteine hydrolase family protein -
  AKO66_RS04990 (AKO66_04980) - 996716..998185 (+) 1470 WP_007500472.1 nicotinate phosphoribosyltransferase -
  AKO66_RS04995 (AKO66_04985) - 998327..999553 (+) 1227 WP_017367964.1 EAL and HDOD domain-containing protein -
  AKO66_RS05000 (AKO66_04990) - 999590..999943 (-) 354 WP_017367963.1 hypothetical protein -
  AKO66_RS05005 (AKO66_04995) degQ 1000449..1000589 (+) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  AKO66_RS05010 (AKO66_05000) - 1000741..1001664 (+) 924 WP_008345863.1 polyprenyl synthetase family protein -
  AKO66_RS05015 (AKO66_05005) comX 1001642..1001812 (+) 171 WP_017358941.1 competence pheromone ComX -
  AKO66_RS05020 (AKO66_05010) comP 1001826..1004132 (+) 2307 WP_017367961.1 ATP-binding protein Regulator
  AKO66_RS05025 (AKO66_05015) comA 1004213..1004854 (+) 642 WP_007500477.1 response regulator transcription factor Regulator
  AKO66_RS05030 (AKO66_05020) - 1004877..1005266 (+) 390 WP_017358943.1 hotdog fold thioesterase -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=153487 AKO66_RS05005 WP_003213123.1 1000449..1000589(+) (degQ) [Bacillus altitudinis strain NJ-V]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=153487 AKO66_RS05005 WP_003213123.1 1000449..1000589(+) (degQ) [Bacillus altitudinis strain NJ-V]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAACTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696


Multiple sequence alignment