Detailed information
Bioinformatically predicted
Overview
| Name | degQ | Type | Regulator |
| Locus tag | AKO65_RS08680 | Genome accession | NZ_CP012329 |
| Coordinates | 1757236..1757376 (+) | Length | 46 a.a. |
| NCBI ID | WP_003213123.1 | Uniprot ID | A0A5K1N966 |
| Organism | Bacillus altitudinis strain NJ-M2 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1752236..1762376
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AKO65_RS08655 (AKO65_08655) | - | 1752466..1752873 (+) | 408 | WP_007500468.1 | YueI family protein | - |
| AKO65_RS08660 (AKO65_08660) | - | 1752934..1753485 (+) | 552 | WP_025207909.1 | cysteine hydrolase family protein | - |
| AKO65_RS08665 (AKO65_08665) | - | 1753503..1754972 (+) | 1470 | WP_007500472.1 | nicotinate phosphoribosyltransferase | - |
| AKO65_RS08670 (AKO65_08670) | - | 1755114..1756340 (+) | 1227 | WP_017367964.1 | EAL and HDOD domain-containing protein | - |
| AKO65_RS08675 (AKO65_08675) | - | 1756377..1756730 (-) | 354 | WP_017367963.1 | hypothetical protein | - |
| AKO65_RS08680 (AKO65_08680) | degQ | 1757236..1757376 (+) | 141 | WP_003213123.1 | degradation enzyme regulation protein DegQ | Regulator |
| AKO65_RS08685 (AKO65_08685) | - | 1757528..1758451 (+) | 924 | WP_008345863.1 | polyprenyl synthetase family protein | - |
| AKO65_RS08690 (AKO65_08690) | comX | 1758429..1758599 (+) | 171 | WP_017358941.1 | competence pheromone ComX | - |
| AKO65_RS08695 (AKO65_08695) | comP | 1758613..1760919 (+) | 2307 | WP_017367961.1 | ATP-binding protein | Regulator |
| AKO65_RS08700 (AKO65_08700) | comA | 1761000..1761641 (+) | 642 | WP_007500477.1 | response regulator transcription factor | Regulator |
| AKO65_RS08705 (AKO65_08705) | - | 1761664..1762053 (+) | 390 | WP_017358943.1 | hotdog fold thioesterase | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5677.42 Da Isoelectric Point: 4.6828
>NTDB_id=153430 AKO65_RS08680 WP_003213123.1 1757236..1757376(+) (degQ) [Bacillus altitudinis strain NJ-M2]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=153430 AKO65_RS08680 WP_003213123.1 1757236..1757376(+) (degQ) [Bacillus altitudinis strain NJ-M2]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAACTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA
ATGGAAAAGTATGAAATCGAAGAACTTAAACAACTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
68.085 |
100 |
0.696 |