Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   V471_RS01980 Genome accession   NZ_CP015283
Coordinates   393184..393414 (-) Length   76 a.a.
NCBI ID   WP_084871057.1    Uniprot ID   -
Organism   Streptococcus salivarius strain ATCC 25975     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 388184..398414
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V471_RS01945 (V471_01950) - 388578..389024 (-) 447 WP_084871055.1 CAAX protease -
  V471_RS01950 (V471_01955) - 389098..389754 (-) 657 WP_084871056.1 CPBP family intramembrane glutamic endopeptidase -
  V471_RS01955 (V471_01960) - 389766..389963 (-) 198 WP_002885716.1 helix-turn-helix transcriptional regulator -
  V471_RS01960 (V471_01965) - 390214..391407 (-) 1194 WP_003095894.1 acetate kinase -
  V471_RS01965 (V471_01970) comGH 391464..392420 (-) 957 WP_037601477.1 class I SAM-dependent methyltransferase Machinery gene
  V471_RS01970 (V471_01975) comGG 392465..392782 (-) 318 WP_037601475.1 competence type IV pilus minor pilin ComGG Machinery gene
  V471_RS01975 (V471_01980) comGF 392760..393197 (-) 438 WP_037601472.1 competence type IV pilus minor pilin ComGF Machinery gene
  V471_RS01980 (V471_01985) comGE 393184..393414 (-) 231 WP_084871057.1 competence type IV pilus minor pilin ComGE Machinery gene
  V471_RS01985 (V471_01990) comGD 393446..393874 (-) 429 WP_014632541.1 competence type IV pilus minor pilin ComGD Machinery gene
  V471_RS01990 (V471_01995) comGC 393834..394148 (-) 315 WP_037611125.1 competence type IV pilus major pilin ComGC Machinery gene
  V471_RS01995 (V471_02000) comGB 394157..395257 (-) 1101 WP_138261574.1 competence type IV pilus assembly protein ComGB Machinery gene
  V471_RS02000 (V471_02005) comGA/cglA/cilD 395139..396080 (-) 942 WP_002887018.1 competence type IV pilus ATPase ComGA Machinery gene
  V471_RS02005 (V471_02010) - 396114..397592 (-) 1479 WP_084871058.1 IS1182 family transposase -
  V471_RS02010 (V471_02015) - 397722..398084 (-) 363 WP_049529260.1 DUF1033 family protein -

Sequence


Protein


Download         Length: 76 a.a.        Molecular weight: 8371.81 Da        Isoelectric Point: 10.3610

>NTDB_id=153121 V471_RS01980 WP_084871057.1 393184..393414(-) (comGE) [Streptococcus salivarius strain ATCC 25975]
MAVLVLVSGLILNQINTNRRLMAENLHQQEVLSVATMAVQTKQDQLTLNGITVTVKRSKQGIAVYESGKEIIHVSK

Nucleotide


Download         Length: 231 bp        

>NTDB_id=153121 V471_RS01980 WP_084871057.1 393184..393414(-) (comGE) [Streptococcus salivarius strain ATCC 25975]
ATGGCTGTCTTAGTACTTGTCAGTGGTCTTATCTTGAATCAGATCAATACCAATCGTAGACTAATGGCTGAGAATCTCCA
TCAACAAGAGGTCTTGAGTGTGGCAACCATGGCTGTTCAGACCAAACAGGATCAGTTGACCTTAAATGGTATCACAGTGA
CAGTAAAACGTAGCAAGCAAGGTATCGCGGTTTATGAATCGGGAAAGGAGATTATTCATGTCTCTAAATAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Streptococcus mutans UA140

38.158

100

0.382

  comGE Streptococcus mutans UA159

38.158

100

0.382