Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   NX99_RS07590 Genome accession   NZ_CP015282
Coordinates   1656876..1657106 (+) Length   76 a.a.
NCBI ID   WP_021144685.1    Uniprot ID   -
Organism   Streptococcus salivarius strain ATCC 27945     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1651876..1662106
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NX99_RS07565 (NX99_07425) - 1653768..1654130 (+) 363 WP_002887019.1 DUF1033 family protein -
  NX99_RS07570 (NX99_07430) comGA/cglA/cilD 1654210..1655151 (+) 942 WP_002887018.1 competence type IV pilus ATPase ComGA Machinery gene
  NX99_RS07575 (NX99_07435) comGB 1655033..1656133 (+) 1101 WP_148263031.1 competence type IV pilus assembly protein ComGB Machinery gene
  NX99_RS07580 (NX99_07440) comGC 1656142..1656456 (+) 315 WP_037611125.1 competence type IV pilus major pilin ComGC Machinery gene
  NX99_RS07585 (NX99_07445) comGD 1656416..1656844 (+) 429 WP_253183813.1 competence type IV pilus minor pilin ComGD Machinery gene
  NX99_RS07590 (NX99_07450) comGE 1656876..1657106 (+) 231 WP_021144685.1 competence type IV pilus minor pilin ComGE Machinery gene
  NX99_RS07595 (NX99_07455) comGF 1657093..1657530 (+) 438 WP_021144684.1 competence type IV pilus minor pilin ComGF Machinery gene
  NX99_RS07600 (NX99_07460) comGG 1657508..1657825 (+) 318 WP_021144683.1 competence type IV pilus minor pilin ComGG Machinery gene
  NX99_RS07605 (NX99_07465) comGH 1657870..1658826 (+) 957 WP_002885753.1 class I SAM-dependent methyltransferase Machinery gene
  NX99_RS07610 (NX99_07470) - 1658883..1660076 (+) 1194 WP_002885831.1 acetate kinase -
  NX99_RS07615 (NX99_07475) - 1660327..1660524 (+) 198 WP_002885716.1 helix-turn-helix transcriptional regulator -
  NX99_RS07620 (NX99_07480) - 1660536..1661192 (+) 657 WP_084915247.1 CPBP family intramembrane glutamic endopeptidase -
  NX99_RS07625 (NX99_07485) - 1661272..1661718 (+) 447 WP_084915249.1 CAAX protease -

Sequence


Protein


Download         Length: 76 a.a.        Molecular weight: 8413.85 Da        Isoelectric Point: 10.4655

>NTDB_id=153056 NX99_RS07590 WP_021144685.1 1656876..1657106(+) (comGE) [Streptococcus salivarius strain ATCC 27945]
MAVLVLVSGLILEQINTNRRLMARNLHQQEVLSVATMAVQTKQDQLTLNGITVTVKRSKQGIAVYESGKEIIHVSQ

Nucleotide


Download         Length: 231 bp        

>NTDB_id=153056 NX99_RS07590 WP_021144685.1 1656876..1657106(+) (comGE) [Streptococcus salivarius strain ATCC 27945]
ATGGCTGTTTTAGTACTTGTCAGTGGTCTTATTTTGGAACAAATCAATACCAATCGTAGGCTAATGGCTAGGAATCTCCA
CCAACAGGAGGTCTTGAGTGTGGCAACCATGGCAGTTCAGACCAAACAGGATCAGTTGACCTTAAATGGCATCACAGTGA
CAGTTAAACGTAGCAAGCAAGGTATCGCGGTTTATGAATCAGGAAAGGAGATTATTCATGTCTCTCAATAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Streptococcus mutans UA140

37.838

97.368

0.368

  comGE Streptococcus mutans UA159

37.838

97.368

0.368