Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGC   Type   Machinery gene
Locus tag   AFK25_RS10005 Genome accession   NZ_CP012152
Coordinates   1902592..1902894 (-) Length   100 a.a.
NCBI ID   WP_019416931.1    Uniprot ID   -
Organism   Anoxybacillus gonensis strain G2     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1897592..1907894
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AFK25_RS09965 (AFK25_09985) - 1897913..1899556 (+) 1644 WP_035066776.1 DEAD/DEAH box helicase -
  AFK25_RS09970 (AFK25_09990) - 1899543..1900313 (+) 771 WP_035066773.1 YqhG family protein -
  AFK25_RS09975 (AFK25_09995) - 1900328..1900516 (-) 189 WP_019416934.1 YqzE family protein -
  AFK25_RS09980 (AFK25_10000) - 1900543..1901049 (-) 507 WP_035066770.1 shikimate kinase -
  AFK25_RS09985 (AFK25_10005) comGG 1901063..1901479 (-) 417 WP_009373938.1 competence type IV pilus minor pilin ComGG -
  AFK25_RS09990 (AFK25_10010) comGF 1901439..1901873 (-) 435 WP_035066767.1 competence type IV pilus minor pilin ComGF -
  AFK25_RS09995 (AFK25_10015) comGE 1901870..1902178 (-) 309 WP_035066764.1 competence type IV pilus minor pilin ComGE -
  AFK25_RS10000 (AFK25_10020) comGD 1902162..1902599 (-) 438 WP_009373943.1 competence type IV pilus minor pilin ComGD -
  AFK25_RS10005 (AFK25_10025) comGC 1902592..1902894 (-) 303 WP_019416931.1 competence type IV pilus major pilin ComGC Machinery gene
  AFK25_RS10010 (AFK25_10030) comGB 1902901..1903932 (-) 1032 WP_035066761.1 competence type IV pilus assembly protein ComGB -
  AFK25_RS10015 (AFK25_10035) comGA 1903916..1904986 (-) 1071 WP_026011547.1 competence type IV pilus ATPase ComGA Machinery gene
  AFK25_RS10020 (AFK25_10040) - 1905098..1905469 (-) 372 WP_009373947.1 Spx/MgsR family RNA polymerase-binding regulatory protein -
  AFK25_RS10025 (AFK25_10045) - 1905657..1906355 (+) 699 WP_035066758.1 helix-turn-helix transcriptional regulator -
  AFK25_RS10030 (AFK25_10050) - 1906425..1906667 (+) 243 WP_009373952.1 DUF2626 domain-containing protein -
  AFK25_RS10035 (AFK25_10055) - 1906696..1907799 (-) 1104 WP_049720895.1 class I SAM-dependent methyltransferase -

Sequence

Protein


Download         Length: 100 a.a.        Molecular weight: 11275.27 Da        Isoelectric Point: 5.6719

>NTDB_id=151916 AFK25_RS10005 WP_019416931.1 1902592..1902894(-) (comGC) [Anoxybacillus gonensis strain G2]
MYMRNEKGFTLIEMLIVLMVITILILITIPNVTKHNSMINNKGCSAFLKMVQSQVKAYEMEHGTIPTVQQLVDGKYIESN
RCPNGKEIVITSEGDVLESE

Nucleotide


Download         Length: 303 bp        

>NTDB_id=151916 AFK25_RS10005 WP_019416931.1 1902592..1902894(-) (comGC) [Anoxybacillus gonensis strain G2]
ATGTATATGAGAAATGAAAAAGGATTTACGCTAATTGAAATGTTAATTGTGTTAATGGTCATTACTATTTTGATTTTAAT
TACGATCCCAAATGTGACAAAACATAACAGTATGATTAACAACAAAGGATGTTCAGCGTTTTTAAAGATGGTTCAATCAC
AGGTAAAAGCATATGAAATGGAGCACGGAACGATTCCGACGGTGCAACAGTTAGTAGATGGAAAATATATTGAAAGTAAC
CGTTGTCCAAACGGAAAAGAAATCGTGATTACGAGTGAAGGGGACGTTTTAGAAAGTGAATGA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(3-28)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

54.444

90

0.49

Multiple sequence alignment