Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | AC241_RS12860 | Genome accession | NZ_CP012099 |
| Coordinates | 2500571..2500849 (+) | Length | 92 a.a. |
| NCBI ID | WP_050843712.1 | Uniprot ID | - |
| Organism | Bacillus thuringiensis strain HS18-1 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2489077..2534500 | 2500571..2500849 | within | 0 |
Gene organization within MGE regions
Location: 2489077..2534500
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AC241_RS12790 (AC241_12795) | - | 2489077..2489340 (+) | 264 | WP_029442397.1 | DUF3937 family protein | - |
| AC241_RS12795 (AC241_12800) | - | 2489891..2490220 (+) | 330 | WP_048564718.1 | heterocycloanthracin/sonorensin family bacteriocin | - |
| AC241_RS12800 (AC241_12805) | - | 2490714..2491199 (+) | 486 | WP_050843695.1 | hypothetical protein | - |
| AC241_RS12805 (AC241_12810) | - | 2491508..2492209 (+) | 702 | WP_050843696.1 | pPIWI_RE module domain-containing protein | - |
| AC241_RS12810 (AC241_12815) | - | 2492248..2493357 (-) | 1110 | WP_050843698.1 | tyrosine-type recombinase/integrase | - |
| AC241_RS12815 (AC241_12820) | - | 2493766..2494098 (-) | 333 | WP_050843700.1 | hypothetical protein | - |
| AC241_RS12820 (AC241_12825) | - | 2494154..2496055 (-) | 1902 | WP_050843702.1 | DEAD/DEAH box helicase | - |
| AC241_RS12825 (AC241_12830) | - | 2496565..2497716 (+) | 1152 | WP_050843704.1 | AimR family lysis-lysogeny pheromone receptor | - |
| AC241_RS12830 (AC241_12835) | - | 2497754..2497900 (+) | 147 | WP_050843706.1 | hypothetical protein | - |
| AC241_RS35695 | - | 2498060..2498188 (+) | 129 | WP_000836783.1 | hypothetical protein | - |
| AC241_RS12835 (AC241_12840) | - | 2498225..2498578 (-) | 354 | WP_000491236.1 | helix-turn-helix domain-containing protein | - |
| AC241_RS12840 (AC241_12845) | - | 2498779..2498970 (+) | 192 | WP_000854271.1 | helix-turn-helix domain-containing protein | - |
| AC241_RS12845 (AC241_12850) | - | 2499027..2499293 (+) | 267 | WP_000522030.1 | helix-turn-helix domain-containing protein | - |
| AC241_RS34775 (AC241_12855) | - | 2499293..2499457 (+) | 165 | WP_050843708.1 | hypothetical protein | - |
| AC241_RS12855 (AC241_12860) | - | 2499515..2500567 (+) | 1053 | WP_050843710.1 | DnaD domain-containing protein | - |
| AC241_RS12860 (AC241_12865) | abrB | 2500571..2500849 (+) | 279 | WP_050843712.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| AC241_RS12865 (AC241_12870) | - | 2500842..2501201 (+) | 360 | WP_001125949.1 | hypothetical protein | - |
| AC241_RS12870 (AC241_12875) | - | 2501220..2501387 (+) | 168 | WP_000717826.1 | DUF3954 domain-containing protein | - |
| AC241_RS12875 (AC241_12880) | - | 2501414..2501665 (+) | 252 | WP_025709558.1 | hypothetical protein | - |
| AC241_RS12880 (AC241_12885) | - | 2501685..2502140 (+) | 456 | WP_050843714.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| AC241_RS35890 (AC241_12890) | - | 2502361..2503086 (-) | 726 | WP_050843716.1 | exosporium leader peptide-containing protein | - |
| AC241_RS12890 (AC241_12895) | - | 2503353..2504081 (-) | 729 | WP_050843718.1 | hypothetical protein | - |
| AC241_RS12895 (AC241_12900) | - | 2504357..2505145 (-) | 789 | WP_050843721.1 | sulfotransferase family 2 domain-containing protein | - |
| AC241_RS12900 (AC241_12905) | - | 2505302..2505640 (-) | 339 | WP_050843723.1 | hypothetical protein | - |
| AC241_RS12905 (AC241_12910) | - | 2505875..2506234 (-) | 360 | WP_050843725.1 | septum formation initiator family protein | - |
| AC241_RS34780 | - | 2506943..2507116 (+) | 174 | WP_176521904.1 | hypothetical protein | - |
| AC241_RS12910 (AC241_12915) | - | 2507148..2507426 (+) | 279 | WP_050843728.1 | hypothetical protein | - |
| AC241_RS12915 (AC241_12920) | - | 2507470..2507991 (-) | 522 | WP_050843730.1 | restriction endonuclease | - |
| AC241_RS12920 (AC241_12925) | - | 2508213..2508410 (+) | 198 | WP_050843733.1 | hypothetical protein | - |
| AC241_RS34785 (AC241_12930) | - | 2508527..2508697 (+) | 171 | WP_050843736.1 | hypothetical protein | - |
| AC241_RS12930 (AC241_12935) | - | 2508725..2509207 (+) | 483 | WP_050843737.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| AC241_RS12935 (AC241_12940) | - | 2509207..2509749 (+) | 543 | WP_050843739.1 | site-specific integrase | - |
| AC241_RS35180 (AC241_12945) | - | 2510079..2510261 (+) | 183 | WP_029442416.1 | hypothetical protein | - |
| AC241_RS12945 (AC241_12950) | - | 2510454..2510909 (+) | 456 | WP_050843740.1 | GNAT family N-acetyltransferase | - |
| AC241_RS12950 (AC241_12955) | - | 2511238..2511915 (+) | 678 | WP_050843742.1 | hypothetical protein | - |
| AC241_RS12955 (AC241_12960) | - | 2512302..2512535 (+) | 234 | WP_050843744.1 | hypothetical protein | - |
| AC241_RS12960 (AC241_12965) | - | 2512532..2512912 (-) | 381 | WP_050843746.1 | DUF2513 domain-containing protein | - |
| AC241_RS34790 | - | 2513053..2513208 (+) | 156 | WP_196303429.1 | hypothetical protein | - |
| AC241_RS12965 (AC241_12970) | - | 2513208..2513423 (+) | 216 | WP_050843748.1 | hypothetical protein | - |
| AC241_RS12970 (AC241_12975) | - | 2513442..2513696 (+) | 255 | WP_050843750.1 | hypothetical protein | - |
| AC241_RS12975 (AC241_12980) | - | 2513686..2514057 (+) | 372 | WP_050843752.1 | HNH endonuclease | - |
| AC241_RS12980 (AC241_12985) | - | 2514194..2514697 (+) | 504 | WP_080990785.1 | phage terminase small subunit P27 family | - |
| AC241_RS12985 (AC241_12990) | - | 2514699..2516393 (+) | 1695 | WP_050843754.1 | terminase large subunit | - |
| AC241_RS12990 (AC241_12995) | - | 2516582..2517835 (+) | 1254 | WP_050843756.1 | phage portal protein | - |
| AC241_RS12995 (AC241_13000) | - | 2517822..2518532 (+) | 711 | WP_050843758.1 | head maturation protease, ClpP-related | - |
| AC241_RS13000 (AC241_13005) | - | 2518570..2519742 (+) | 1173 | WP_050843760.1 | phage major capsid protein | - |
| AC241_RS13005 (AC241_13010) | - | 2519763..2520050 (+) | 288 | WP_050843762.1 | head-tail connector protein | - |
| AC241_RS13010 (AC241_13015) | - | 2520037..2520360 (+) | 324 | WP_050843763.1 | phage head closure protein | - |
| AC241_RS13015 (AC241_13020) | - | 2520353..2520787 (+) | 435 | WP_050843765.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| AC241_RS13020 (AC241_13025) | - | 2520784..2521143 (+) | 360 | WP_050843767.1 | tail completion protein gp17 | - |
| AC241_RS13025 (AC241_13030) | - | 2521144..2521749 (+) | 606 | WP_050843769.1 | major tail protein | - |
| AC241_RS13030 (AC241_13035) | gpG | 2521798..2522115 (+) | 318 | WP_050843770.1 | phage tail assembly chaperone G | - |
| AC241_RS34295 | - | 2522145..2522321 (+) | 177 | WP_000344056.1 | hypothetical protein | - |
| AC241_RS13035 (AC241_13040) | - | 2522337..2523617 (+) | 1281 | Protein_2491 | phage tail tape measure protein | - |
| AC241_RS13040 (AC241_13045) | - | 2523834..2526452 (+) | 2619 | WP_050843774.1 | phage tail tape measure protein | - |
| AC241_RS13045 (AC241_13050) | - | 2526467..2527948 (+) | 1482 | WP_080990786.1 | distal tail protein Dit | - |
| AC241_RS13050 (AC241_13055) | - | 2527945..2531976 (+) | 4032 | WP_050843776.1 | phage tail spike protein | - |
| AC241_RS13055 (AC241_13060) | - | 2532014..2532250 (+) | 237 | WP_050843778.1 | hemolysin XhlA family protein | - |
| AC241_RS13060 (AC241_13065) | - | 2532250..2532489 (+) | 240 | WP_000461723.1 | hypothetical protein | - |
| AC241_RS13065 (AC241_13070) | - | 2532486..2533550 (+) | 1065 | WP_050843780.1 | N-acetylmuramoyl-L-alanine amidase | - |
| AC241_RS13070 (AC241_13075) | - | 2533592..2534500 (+) | 909 | WP_050843782.1 | exosporium leader peptide-containing protein | - |
Sequence
Protein
Download Length: 92 a.a. Molecular weight: 10110.70 Da Isoelectric Point: 7.2798
>NTDB_id=151388 AC241_RS12860 WP_050843712.1 2500571..2500849(+) (abrB) [Bacillus thuringiensis strain HS18-1]
MKNTGVARKVDELGRVVIPVELRRTLGITKGTALDFHIDGENIVLRKHEKSCFVTGEVSETNIELLGGRMFLSKEGASEL
LDFIQKSGMAHA
MKNTGVARKVDELGRVVIPVELRRTLGITKGTALDFHIDGENIVLRKHEKSCFVTGEVSETNIELLGGRMFLSKEGASEL
LDFIQKSGMAHA
Nucleotide
Download Length: 279 bp
>NTDB_id=151388 AC241_RS12860 WP_050843712.1 2500571..2500849(+) (abrB) [Bacillus thuringiensis strain HS18-1]
ATGAAAAATACAGGCGTTGCAAGAAAAGTGGACGAGCTAGGTCGTGTAGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
TATTACCAAAGGAACGGCACTAGATTTTCATATCGATGGTGAAAACATTGTTTTAAGAAAACATGAAAAGTCATGCTTTG
TAACGGGTGAAGTTTCTGAAACCAACATAGAGTTGCTTGGTGGCCGAATGTTTTTAAGCAAGGAAGGGGCAAGTGAATTA
CTGGATTTTATTCAGAAGAGTGGGATGGCACATGCCTAA
ATGAAAAATACAGGCGTTGCAAGAAAAGTGGACGAGCTAGGTCGTGTAGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
TATTACCAAAGGAACGGCACTAGATTTTCATATCGATGGTGAAAACATTGTTTTAAGAAAACATGAAAAGTCATGCTTTG
TAACGGGTGAAGTTTCTGAAACCAACATAGAGTTGCTTGGTGGCCGAATGTTTTTAAGCAAGGAAGGGGCAAGTGAATTA
CTGGATTTTATTCAGAAGAGTGGGATGGCACATGCCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
57.471 |
94.565 |
0.543 |