Detailed information    

insolico Bioinformatically predicted

Overview


Name   abrB   Type   Regulator
Locus tag   AC241_RS07260 Genome accession   NZ_CP012099
Coordinates   1386483..1386761 (+) Length   92 a.a.
NCBI ID   WP_050842979.1    Uniprot ID   -
Organism   Bacillus thuringiensis strain HS18-1     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1378373..1416636 1386483..1386761 within 0


Gene organization within MGE regions


Location: 1378373..1416636
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AC241_RS07200 (AC241_07195) - 1378373..1379482 (-) 1110 WP_029437994.1 tyrosine-type recombinase/integrase -
  AC241_RS34260 - 1379682..1379837 (+) 156 WP_155417051.1 hypothetical protein -
  AC241_RS07205 (AC241_07200) - 1379903..1380247 (-) 345 WP_050842967.1 helix-turn-helix domain-containing protein -
  AC241_RS07210 (AC241_07205) - 1380772..1381911 (+) 1140 WP_050842969.1 AimR family lysis-lysogeny pheromone receptor -
  AC241_RS34700 - 1381915..1382052 (+) 138 WP_162901155.1 hypothetical protein -
  AC241_RS34265 - 1382202..1382354 (+) 153 WP_155417052.1 hypothetical protein -
  AC241_RS07215 (AC241_07210) - 1382361..1382708 (-) 348 WP_029437997.1 helix-turn-helix domain-containing protein -
  AC241_RS07220 (AC241_07215) - 1382884..1383102 (+) 219 WP_033694466.1 helix-turn-helix domain-containing protein -
  AC241_RS07225 (AC241_07220) - 1383160..1383834 (+) 675 WP_029437999.1 Rha family transcriptional regulator -
  AC241_RS07230 (AC241_07225) - 1383872..1384147 (+) 276 WP_029438000.1 helix-turn-helix domain-containing protein -
  AC241_RS34705 (AC241_07235) - 1384377..1384553 (+) 177 WP_050842971.1 hypothetical protein -
  AC241_RS07245 (AC241_07240) - 1384558..1385421 (+) 864 WP_050842973.1 conserved phage C-terminal domain-containing protein -
  AC241_RS07250 (AC241_07245) - 1385363..1386238 (+) 876 WP_050842975.1 DnaA ATPase domain-containing protein -
  AC241_RS07255 (AC241_07250) - 1386272..1386466 (+) 195 WP_050842977.1 hypothetical protein -
  AC241_RS07260 (AC241_07255) abrB 1386483..1386761 (+) 279 WP_050842979.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  AC241_RS07265 (AC241_07260) - 1386754..1387113 (+) 360 WP_050842981.1 hypothetical protein -
  AC241_RS07270 (AC241_07265) - 1387141..1387305 (+) 165 WP_050842983.1 DUF3954 domain-containing protein -
  AC241_RS07275 (AC241_07270) - 1387333..1387581 (+) 249 WP_050842985.1 hypothetical protein -
  AC241_RS07280 (AC241_07275) - 1387590..1387856 (-) 267 WP_050842986.1 hypothetical protein -
  AC241_RS07285 (AC241_07280) - 1387980..1388489 (+) 510 WP_050842989.1 dUTP diphosphatase -
  AC241_RS07295 (AC241_07290) - 1388979..1389578 (+) 600 WP_016081488.1 hypothetical protein -
  AC241_RS34710 (AC241_07295) - 1390346..1390510 (+) 165 WP_050842992.1 hypothetical protein -
  AC241_RS07305 (AC241_07300) - 1390692..1390883 (+) 192 WP_000074682.1 hypothetical protein -
  AC241_RS34270 - 1391216..1391422 (+) 207 WP_141558559.1 hypothetical protein -
  AC241_RS07315 (AC241_07310) - 1391461..1391583 (+) 123 WP_050842994.1 DUF3983 domain-containing protein -
  AC241_RS34715 (AC241_07315) - 1391699..1391869 (+) 171 WP_000677279.1 hypothetical protein -
  AC241_RS07325 (AC241_07320) - 1391897..1392379 (+) 483 WP_050842995.1 ArpU family phage packaging/lysis transcriptional regulator -
  AC241_RS07330 (AC241_07325) - 1392379..1392921 (+) 543 WP_050842997.1 site-specific integrase -
  AC241_RS07335 (AC241_07330) - 1393132..1393350 (+) 219 WP_050843000.1 hypothetical protein -
  AC241_RS07340 (AC241_07335) - 1393789..1393977 (+) 189 WP_050843002.1 hypothetical protein -
  AC241_RS07345 (AC241_07340) - 1394044..1394919 (+) 876 WP_050843004.1 hypothetical protein -
  AC241_RS07350 (AC241_07345) - 1395017..1395319 (+) 303 WP_050844811.1 hypothetical protein -
  AC241_RS07355 (AC241_07350) - 1395306..1395518 (+) 213 WP_050843006.1 hypothetical protein -
  AC241_RS07360 (AC241_07355) - 1395655..1395909 (+) 255 WP_050843008.1 hypothetical protein -
  AC241_RS07365 (AC241_07360) - 1395902..1396255 (+) 354 WP_050843010.1 hypothetical protein -
  AC241_RS35865 (AC241_07370) - 1396435..1396611 (+) 177 WP_050844812.1 helix-turn-helix domain-containing protein -
  AC241_RS07375 (AC241_07375) - 1396616..1396843 (+) 228 WP_050843012.1 hypothetical protein -
  AC241_RS07380 (AC241_07380) - 1396846..1397181 (+) 336 WP_050843014.1 HNH endonuclease -
  AC241_RS07385 (AC241_07385) - 1397334..1397690 (+) 357 WP_050843017.1 hypothetical protein -
  AC241_RS07390 (AC241_07390) - 1397687..1399342 (+) 1656 WP_050843019.1 terminase TerL endonuclease subunit -
  AC241_RS07395 (AC241_07395) - 1399347..1400513 (+) 1167 WP_050843021.1 phage portal protein -
  AC241_RS07400 (AC241_07400) - 1400497..1401279 (+) 783 WP_050843023.1 head maturation protease, ClpP-related -
  AC241_RS07405 (AC241_07405) - 1401283..1402434 (+) 1152 WP_050843024.1 phage major capsid protein -
  AC241_RS07410 (AC241_07410) - 1402440..1402733 (+) 294 WP_050843026.1 hypothetical protein -
  AC241_RS07415 (AC241_07415) - 1402735..1403088 (+) 354 WP_030028310.1 phage head closure protein -
  AC241_RS07420 (AC241_07420) - 1403090..1403434 (+) 345 WP_050843028.1 HK97 gp10 family phage protein -
  AC241_RS07425 (AC241_07425) - 1403431..1403760 (+) 330 WP_050843030.1 hypothetical protein -
  AC241_RS07430 (AC241_07430) - 1403761..1404357 (+) 597 WP_016124651.1 major tail protein -
  AC241_RS07435 (AC241_07435) - 1404362..1404724 (+) 363 WP_050843032.1 hypothetical protein -
  AC241_RS07440 (AC241_07440) - 1404955..1408575 (+) 3621 WP_050843034.1 hypothetical protein -
  AC241_RS07445 (AC241_07445) - 1408617..1410092 (+) 1476 WP_050843037.1 distal tail protein Dit -
  AC241_RS07450 (AC241_07450) - 1410089..1414180 (+) 4092 WP_050843039.1 phage tail spike protein -
  AC241_RS07455 (AC241_07455) - 1414470..1414778 (-) 309 WP_050843041.1 hypothetical protein -
  AC241_RS07460 (AC241_07460) - 1414979..1415203 (+) 225 WP_050843043.1 hypothetical protein -
  AC241_RS07465 (AC241_07465) - 1415280..1415714 (+) 435 WP_050843045.1 holin family protein -
  AC241_RS07470 (AC241_07470) - 1415704..1416636 (+) 933 WP_050843047.1 N-acetylmuramoyl-L-alanine amidase -

Sequence


Protein


Download         Length: 92 a.a.        Molecular weight: 10114.73 Da        Isoelectric Point: 5.1693

>NTDB_id=151383 AC241_RS07260 WP_050842979.1 1386483..1386761(+) (abrB) [Bacillus thuringiensis strain HS18-1]
MKNTGVVRKVDELGRLVIPVELRRTLGIAEGTALDFHVDGENIILRKPEKSCFVTGEVSESNIELLGGRMVLSKEGASEL
LDLLQKNVMEHA

Nucleotide


Download         Length: 279 bp        

>NTDB_id=151383 AC241_RS07260 WP_050842979.1 1386483..1386761(+) (abrB) [Bacillus thuringiensis strain HS18-1]
ATGAAAAATACAGGTGTTGTAAGAAAAGTGGACGAGCTAGGGCGATTAGTAATTCCAGTTGAATTGCGCAGGACCTTAGG
TATTGCTGAAGGGACAGCGTTAGACTTTCATGTTGACGGAGAAAACATCATTTTAAGAAAACCAGAAAAGTCATGTTTTG
TAACAGGTGAAGTGTCTGAATCCAACATCGAATTGTTAGGCGGCCGAATGGTTTTGAGTAAGGAAGGGGCAAGTGAGTTA
TTGGACCTTCTTCAAAAGAATGTGATGGAACATGCCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

63.218

94.565

0.598


Multiple sequence alignment