Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGC   Type   Machinery gene
Locus tag   B34_RS05965 Genome accession   NZ_CP014793
Coordinates   1093063..1093326 (-) Length   87 a.a.
NCBI ID   WP_080624020.1    Uniprot ID   -
Organism   Bacillus licheniformis strain SCDB 34     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1088063..1098326
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  B34_RS05920 (B34_01201) tasA 1088445..1089239 (-) 795 WP_003183447.1 biofilm matrix protein TasA -
  B34_RS05925 (B34_01202) sipW 1089313..1089897 (-) 585 WP_003183449.1 signal peptidase I SipW -
  B34_RS05930 (B34_01203) tapA 1089894..1090622 (-) 729 WP_003183451.1 amyloid fiber anchoring/assembly protein TapA -
  B34_RS05935 (B34_01204) - 1090899..1091219 (+) 321 WP_003183454.1 YqzG/YhdC family protein -
  B34_RS05940 (B34_01205) - 1091243..1091425 (-) 183 WP_003183456.1 YqzE family protein -
  B34_RS05945 (B34_01206) comGG 1091514..1091879 (-) 366 WP_080624019.1 competence type IV pilus minor pilin ComGG Machinery gene
  B34_RS05950 (B34_01207) comGF 1091892..1092380 (-) 489 WP_011201694.1 competence type IV pilus minor pilin ComGF -
  B34_RS05955 comGE 1092289..1092636 (-) 348 WP_026699160.1 competence type IV pilus minor pilin ComGE -
  B34_RS05960 (B34_01208) comGD 1092620..1093057 (-) 438 WP_071583679.1 competence type IV pilus minor pilin ComGD Machinery gene
  B34_RS05965 (B34_01209) comGC 1093063..1093326 (-) 264 WP_080624020.1 competence type IV pilus major pilin ComGC Machinery gene
  B34_RS05970 (B34_01210) - 1093452..1094141 (+) 690 WP_080624021.1 hypothetical protein -
  B34_RS05975 (B34_01211) - 1094308..1095048 (+) 741 WP_080624022.1 helix-turn-helix domain-containing protein -
  B34_RS05980 (B34_01212) - 1095148..1096212 (-) 1065 WP_080624023.1 hypothetical protein -
  B34_RS05985 (B34_01213) - 1096238..1096564 (-) 327 WP_080624024.1 hypothetical protein -
  B34_RS05990 (B34_01214) - 1096838..1097695 (+) 858 WP_080624025.1 SMI1/KNR4 family protein -

Sequence


Protein


Download         Length: 87 a.a.        Molecular weight: 9562.26 Da        Isoelectric Point: 9.6323

>NTDB_id=149878 B34_RS05965 WP_080624020.1 1093063..1093326(-) (comGC) [Bacillus licheniformis strain SCDB 34]
MLVVMLVISILLLITIPNVTKHNQSIQKKGCEGLINMVQAQITAYQMDHDGKTPNRAELESEGYIKKNLKCPNGKAIKIS
NGKAQAD

Nucleotide


Download         Length: 264 bp        

>NTDB_id=149878 B34_RS05965 WP_080624020.1 1093063..1093326(-) (comGC) [Bacillus licheniformis strain SCDB 34]
ATGTTAGTCGTCATGCTCGTTATCTCCATCCTGCTGTTGATCACCATTCCGAATGTGACCAAGCATAACCAAAGCATCCA
AAAGAAAGGATGCGAAGGATTAATCAATATGGTTCAAGCGCAGATCACGGCCTATCAGATGGATCATGACGGGAAAACGC
CGAACAGGGCGGAGCTTGAATCTGAAGGTTACATAAAAAAGAACTTAAAGTGTCCGAATGGGAAAGCAATTAAAATTTCA
AACGGCAAAGCACAGGCTGATTGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

63.38

81.609

0.517


Multiple sequence alignment