Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | AB684_RS17115 | Genome accession | NZ_CP014781 |
| Coordinates | 3309482..3309622 (-) | Length | 46 a.a. |
| NCBI ID | WP_003184860.1 | Uniprot ID | A0ABM6LMF9 |
| Organism | Bacillus licheniformis strain HRBL-15TDI7 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3304482..3314622
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AB684_RS17090 (AB684_17090) | - | 3304753..3305142 (-) | 390 | WP_003184847.1 | hotdog fold thioesterase | - |
| AB684_RS17095 (AB684_17095) | comA | 3305159..3305797 (-) | 639 | WP_003184849.1 | response regulator transcription factor | Regulator |
| AB684_RS17100 (AB684_17100) | comP | 3305884..3308205 (-) | 2322 | WP_026080865.1 | ATP-binding protein | Regulator |
| AB684_RS17105 (AB684_17105) | comX | 3308245..3308409 (-) | 165 | WP_011198251.1 | competence pheromone ComX | - |
| AB684_RS17110 (AB684_17110) | comQ | 3308424..3309293 (-) | 870 | WP_011198252.1 | polyprenyl synthetase family protein | Regulator |
| AB684_RS17115 (AB684_17115) | degQ | 3309482..3309622 (-) | 141 | WP_003184860.1 | degradation enzyme regulation protein DegQ | Regulator |
| AB684_RS17125 (AB684_17125) | - | 3310141..3310455 (+) | 315 | WP_231105283.1 | SDR family oxidoreductase | - |
| AB684_RS17130 (AB684_17130) | - | 3310498..3311718 (-) | 1221 | WP_003184864.1 | EAL and HDOD domain-containing protein | - |
| AB684_RS17135 (AB684_17135) | - | 3311897..3313306 (-) | 1410 | WP_228767691.1 | nicotinate phosphoribosyltransferase | - |
| AB684_RS17140 (AB684_17140) | - | 3313384..3313935 (-) | 552 | WP_003184868.1 | cysteine hydrolase family protein | - |
| AB684_RS17145 (AB684_17145) | - | 3314120..3314521 (-) | 402 | WP_003184870.1 | YueI family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5747.56 Da Isoelectric Point: 8.4596
>NTDB_id=149575 AB684_RS17115 WP_003184860.1 3309482..3309622(-) (degQ) [Bacillus licheniformis strain HRBL-15TDI7]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS
Nucleotide
Download Length: 141 bp
>NTDB_id=149575 AB684_RS17115 WP_003184860.1 3309482..3309622(-) (degQ) [Bacillus licheniformis strain HRBL-15TDI7]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
71.429 |
91.304 |
0.652 |