Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   AB684_RS17115 Genome accession   NZ_CP014781
Coordinates   3309482..3309622 (-) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   A0ABM6LMF9
Organism   Bacillus licheniformis strain HRBL-15TDI7     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3304482..3314622
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB684_RS17090 (AB684_17090) - 3304753..3305142 (-) 390 WP_003184847.1 hotdog fold thioesterase -
  AB684_RS17095 (AB684_17095) comA 3305159..3305797 (-) 639 WP_003184849.1 response regulator transcription factor Regulator
  AB684_RS17100 (AB684_17100) comP 3305884..3308205 (-) 2322 WP_026080865.1 ATP-binding protein Regulator
  AB684_RS17105 (AB684_17105) comX 3308245..3308409 (-) 165 WP_011198251.1 competence pheromone ComX -
  AB684_RS17110 (AB684_17110) comQ 3308424..3309293 (-) 870 WP_011198252.1 polyprenyl synthetase family protein Regulator
  AB684_RS17115 (AB684_17115) degQ 3309482..3309622 (-) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  AB684_RS17125 (AB684_17125) - 3310141..3310455 (+) 315 WP_231105283.1 SDR family oxidoreductase -
  AB684_RS17130 (AB684_17130) - 3310498..3311718 (-) 1221 WP_003184864.1 EAL and HDOD domain-containing protein -
  AB684_RS17135 (AB684_17135) - 3311897..3313306 (-) 1410 WP_228767691.1 nicotinate phosphoribosyltransferase -
  AB684_RS17140 (AB684_17140) - 3313384..3313935 (-) 552 WP_003184868.1 cysteine hydrolase family protein -
  AB684_RS17145 (AB684_17145) - 3314120..3314521 (-) 402 WP_003184870.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=149575 AB684_RS17115 WP_003184860.1 3309482..3309622(-) (degQ) [Bacillus licheniformis strain HRBL-15TDI7]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=149575 AB684_RS17115 WP_003184860.1 3309482..3309622(-) (degQ) [Bacillus licheniformis strain HRBL-15TDI7]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652