Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   AS588_RS03930 Genome accession   NZ_CP014700
Coordinates   782291..782605 (+) Length   104 a.a.
NCBI ID   WP_015388003.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain S499     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 777291..787605
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AS588_RS03905 (AS588_03905) - 778331..779281 (+) 951 WP_014305415.1 magnesium transporter CorA family protein -
  AS588_RS03910 (AS588_03910) comGA 779473..780543 (+) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  AS588_RS03915 (AS588_03915) comGB 780530..781567 (+) 1038 WP_014305414.1 competence type IV pilus assembly protein ComGB Machinery gene
  AS588_RS03920 (AS588_03920) comGC 781614..781880 (+) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  AS588_RS03925 (AS588_03925) comGD 781870..782307 (+) 438 WP_015388002.1 competence type IV pilus minor pilin ComGD Machinery gene
  AS588_RS03930 (AS588_03930) comGE 782291..782605 (+) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  AS588_RS03935 (AS588_03935) comGF 782619..783014 (+) 396 WP_015388004.1 competence type IV pilus minor pilin ComGF Machinery gene
  AS588_RS03940 (AS588_03940) comGG 783015..783392 (+) 378 WP_015388005.1 competence type IV pilus minor pilin ComGG Machinery gene
  AS588_RS03945 (AS588_03945) - 783449..783628 (+) 180 WP_003153093.1 YqzE family protein -
  AS588_RS03950 (AS588_03950) - 783668..783997 (-) 330 WP_003153097.1 DUF3889 domain-containing protein -
  AS588_RS03955 (AS588_03955) tapA 784257..784928 (+) 672 WP_015388007.1 amyloid fiber anchoring/assembly protein TapA -
  AS588_RS03960 (AS588_03960) sipW 784900..785484 (+) 585 WP_012117977.1 signal peptidase I SipW -
  AS588_RS03965 (AS588_03965) tasA 785548..786333 (+) 786 WP_015388008.1 biofilm matrix protein TasA -
  AS588_RS03970 (AS588_03970) sinR 786381..786716 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  AS588_RS03975 (AS588_03975) sinI 786750..786923 (-) 174 WP_003153105.1 anti-repressor SinI Regulator

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11844.85 Da        Isoelectric Point: 6.9470

>NTDB_id=149108 AS588_RS03930 WP_015388003.1 782291..782605(+) (comGE) [Bacillus amyloliquefaciens strain S499]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=149108 AS588_RS03930 WP_015388003.1 782291..782605(+) (comGE) [Bacillus amyloliquefaciens strain S499]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGCGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481