Detailed information
Bioinformatically predicted
Overview
| Name | nucA/comI | Type | Machinery gene |
| Locus tag | VK72_RS14610 | Genome accession | NZ_CP011420 |
| Coordinates | 3350159..3350548 (-) | Length | 129 a.a. |
| NCBI ID | WP_413465550.1 | Uniprot ID | - |
| Organism | Paenibacillus polymyxa strain ATCC 15970 | ||
| Function | cleavage of dsDNA into ssDNA (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 3317402..3360021 | 3350159..3350548 | within | 0 |
Gene organization within MGE regions
Location: 3317402..3360021
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| VK72_RS27830 (VK72_14130) | - | 3317402..3317785 (-) | 384 | WP_179086225.1 | hypothetical protein | - |
| VK72_RS14380 (VK72_14135) | - | 3317798..3318940 (-) | 1143 | WP_075154279.1 | hypothetical protein | - |
| VK72_RS14385 (VK72_14140) | - | 3319093..3319339 (-) | 247 | Protein_2839 | YolD-like family protein | - |
| VK72_RS14390 (VK72_14145) | - | 3320224..3320556 (+) | 333 | WP_023989013.1 | hypothetical protein | - |
| VK72_RS27265 | - | 3320614..3321537 (-) | 924 | WP_081376905.1 | Kelch repeat-containing protein | - |
| VK72_RS14410 (VK72_14155) | - | 3321443..3321910 (-) | 468 | WP_028541737.1 | Kelch repeat-containing protein | - |
| VK72_RS14415 (VK72_14160) | - | 3322185..3322667 (-) | 483 | WP_028541738.1 | hypothetical protein | - |
| VK72_RS14425 (VK72_14165) | - | 3323072..3324520 (-) | 1449 | WP_080751635.1 | 6-phospho-beta-glucosidase | - |
| VK72_RS28585 | - | 3324543..3324731 (-) | 189 | WP_335582454.1 | PTS glucose transporter subunit IIA | - |
| VK72_RS28590 (VK72_14170) | - | 3324704..3325003 (-) | 300 | WP_075154280.1 | PTS glucose transporter subunit IIA | - |
| VK72_RS14440 | - | 3325082..3325219 (-) | 138 | Protein_2847 | PTS transporter subunit EIIB | - |
| VK72_RS14445 (VK72_14175) | - | 3325886..3326791 (+) | 906 | WP_075154281.1 | EamA family transporter | - |
| VK72_RS28885 | - | 3327775..3328017 (+) | 243 | WP_080751636.1 | IS3 family transposase | - |
| VK72_RS27835 | - | 3328082..3328222 (-) | 141 | WP_023989021.1 | hypothetical protein | - |
| VK72_RS14460 (VK72_14190) | - | 3328810..3329580 (-) | 771 | WP_075154282.1 | collagen-like protein | - |
| VK72_RS14470 (VK72_14195) | - | 3330063..3330620 (+) | 558 | WP_049828348.1 | MepB family protein | - |
| VK72_RS28890 | - | 3330737..3330961 (-) | 225 | WP_370671133.1 | DNA methyltransferase | - |
| VK72_RS28895 (VK72_14200) | - | 3330915..3331133 (-) | 219 | WP_023989025.1 | hypothetical protein | - |
| VK72_RS14480 (VK72_14205) | - | 3331538..3331993 (-) | 456 | WP_023989026.1 | DinB family protein | - |
| VK72_RS14485 (VK72_14210) | - | 3332050..3332307 (-) | 258 | WP_075154283.1 | YdcF family protein | - |
| VK72_RS28745 (VK72_14215) | - | 3332590..3333228 (-) | 639 | Protein_2857 | hypothetical protein | - |
| VK72_RS14495 (VK72_14220) | - | 3333364..3333690 (+) | 327 | WP_023989029.1 | hypothetical protein | - |
| VK72_RS28640 | - | 3333752..3333877 (-) | 126 | WP_023989030.1 | hypothetical protein | - |
| VK72_RS27515 | - | 3334048..3334218 (-) | 171 | WP_155613684.1 | hypothetical protein | - |
| VK72_RS14500 (VK72_14225) | - | 3334370..3334582 (-) | 213 | WP_028540714.1 | hypothetical protein | - |
| VK72_RS14505 (VK72_14230) | - | 3334637..3334912 (-) | 276 | WP_023989034.1 | hypothetical protein | - |
| VK72_RS27520 | - | 3335088..3335231 (-) | 144 | WP_155613685.1 | hypothetical protein | - |
| VK72_RS14510 (VK72_14235) | - | 3335705..3336139 (+) | 435 | WP_023989036.1 | hypothetical protein | - |
| VK72_RS14515 (VK72_14240) | - | 3336258..3336479 (+) | 222 | WP_028540712.1 | DUF6199 family natural product biosynthesis protein | - |
| VK72_RS28750 | - | 3336709..3336843 (-) | 135 | Protein_2866 | DNA polymerase III subunit beta | - |
| VK72_RS14530 (VK72_14250) | - | 3337545..3337757 (+) | 213 | WP_069289685.1 | helix-turn-helix domain-containing protein | - |
| VK72_RS14535 (VK72_14255) | - | 3337998..3338393 (-) | 396 | WP_075154284.1 | LytTR family transcriptional regulator DNA-binding domain-containing protein | - |
| VK72_RS14540 | - | 3338408..3338554 (-) | 147 | WP_075154285.1 | cyclic lactone autoinducer peptide | - |
| VK72_RS14545 (VK72_14260) | - | 3338532..3339086 (-) | 555 | WP_075154286.1 | accessory gene regulator ArgB-like protein | - |
| VK72_RS14550 (VK72_14265) | - | 3339064..3339696 (-) | 633 | WP_069289688.1 | hypothetical protein | - |
| VK72_RS14555 (VK72_14270) | - | 3339821..3340153 (-) | 333 | WP_075154287.1 | YolD-like family protein | - |
| VK72_RS28295 | - | 3340315..3341205 (+) | 891 | WP_226887770.1 | hypothetical protein | - |
| VK72_RS28900 | - | 3341421..3341504 (-) | 84 | WP_223822117.1 | putative holin-like toxin | - |
| VK72_RS27840 (VK72_14280) | - | 3341615..3341998 (-) | 384 | WP_193217069.1 | hypothetical protein | - |
| VK72_RS14565 (VK72_14285) | - | 3342019..3343155 (-) | 1137 | WP_075154288.1 | hypothetical protein | - |
| VK72_RS14570 (VK72_14290) | - | 3343410..3344456 (-) | 1047 | WP_075154289.1 | fibronectin type III domain-containing protein | - |
| VK72_RS14575 (VK72_14295) | - | 3344637..3345689 (-) | 1053 | WP_075154290.1 | fibronectin type III domain-containing protein | - |
| VK72_RS14580 (VK72_14300) | nucA/comI | 3345863..3346291 (-) | 429 | WP_075154291.1 | NucA/NucB deoxyribonuclease domain-containing protein | Machinery gene |
| VK72_RS14585 (VK72_14305) | - | 3346431..3347066 (-) | 636 | WP_226887769.1 | hypothetical protein | - |
| VK72_RS14590 (VK72_14310) | - | 3347123..3347689 (-) | 567 | WP_075154293.1 | hypothetical protein | - |
| VK72_RS14595 (VK72_14315) | - | 3347911..3348144 (-) | 234 | WP_075154294.1 | hypothetical protein | - |
| VK72_RS14600 (VK72_14320) | - | 3348273..3349079 (-) | 807 | WP_075154295.1 | hypothetical protein | - |
| VK72_RS14605 | - | 3349404..3350090 (-) | 687 | WP_075154296.1 | hypothetical protein | - |
| VK72_RS14610 (VK72_14330) | nucA/comI | 3350159..3350548 (-) | 390 | WP_413465550.1 | nuclease | Machinery gene |
| VK72_RS14615 (VK72_14335) | - | 3350701..3350931 (-) | 231 | WP_081376908.1 | hypothetical protein | - |
| VK72_RS14620 (VK72_14340) | - | 3351382..3351651 (-) | 270 | WP_081376909.1 | hypothetical protein | - |
| VK72_RS14625 (VK72_14345) | - | 3351868..3352077 (+) | 210 | WP_044788354.1 | YqaE/Pmp3 family membrane protein | - |
| VK72_RS14630 (VK72_14350) | - | 3352229..3353320 (-) | 1092 | WP_075154298.1 | hypothetical protein | - |
| VK72_RS14635 (VK72_14355) | - | 3353415..3354110 (-) | 696 | WP_075154299.1 | hypothetical protein | - |
| VK72_RS14640 (VK72_14360) | - | 3354113..3354892 (-) | 780 | WP_075154300.1 | hypothetical protein | - |
| VK72_RS14645 (VK72_14365) | - | 3355026..3355577 (-) | 552 | WP_075154301.1 | phage holin, LLH family | - |
| VK72_RS14650 (VK72_14370) | - | 3355580..3356536 (-) | 957 | WP_075154302.1 | GH25 family lysozyme | - |
| VK72_RS14655 (VK72_14375) | - | 3356514..3356969 (-) | 456 | WP_231118710.1 | phage holin family protein | - |
| VK72_RS14660 (VK72_14380) | - | 3356993..3357208 (-) | 216 | WP_075155064.1 | hypothetical protein | - |
| VK72_RS14665 (VK72_14385) | - | 3357268..3358044 (-) | 777 | WP_075154303.1 | Bro-N domain-containing protein | - |
| VK72_RS14670 (VK72_14390) | - | 3358563..3358934 (+) | 372 | WP_075154304.1 | hypothetical protein | - |
| VK72_RS14675 (VK72_14395) | - | 3359061..3359363 (+) | 303 | WP_075154305.1 | hypothetical protein | - |
| VK72_RS14680 (VK72_14400) | - | 3359566..3360021 (+) | 456 | WP_075154306.1 | AraC family transcriptional regulator | - |
Sequence
Protein
Download Length: 129 a.a. Molecular weight: 14083.92 Da Isoelectric Point: 6.8641
>NTDB_id=145923 VK72_RS14610 WP_413465550.1 3350159..3350548(-) (nucA/comI) [Paenibacillus polymyxa strain ATCC 15970]
MFIPQDHKAPVVSKQSKTVTTGETVQLEFPSAKYPETAQHIKEAIAAGKSPVCTIDREGADHNRELSLKGVPTKKGKDRD
EWPMAMCSEGGEGADIKYIAPKDNRGAGSWVGHKLDEYADGTKVEFIVK
MFIPQDHKAPVVSKQSKTVTTGETVQLEFPSAKYPETAQHIKEAIAAGKSPVCTIDREGADHNRELSLKGVPTKKGKDRD
EWPMAMCSEGGEGADIKYIAPKDNRGAGSWVGHKLDEYADGTKVEFIVK
Nucleotide
Download Length: 390 bp
>NTDB_id=145923 VK72_RS14610 WP_413465550.1 3350159..3350548(-) (nucA/comI) [Paenibacillus polymyxa strain ATCC 15970]
ATGTTTATTCCGCAAGACCACAAGGCTCCTGTGGTGTCTAAGCAATCGAAAACAGTGACAACGGGCGAGACAGTGCAATT
GGAATTCCCGTCAGCCAAGTATCCTGAAACGGCCCAGCACATTAAGGAGGCCATTGCAGCAGGAAAGTCACCAGTATGCA
CCATAGACCGCGAAGGAGCAGACCATAATCGTGAGTTGTCATTGAAAGGTGTACCCACCAAGAAGGGCAAGGATCGCGAT
GAATGGCCTATGGCGATGTGTTCGGAAGGTGGAGAGGGTGCAGACATTAAGTACATAGCACCAAAGGATAATCGCGGAGC
TGGATCATGGGTAGGACACAAGTTGGACGAATATGCAGATGGAACGAAAGTGGAATTTATCGTAAAGTAG
ATGTTTATTCCGCAAGACCACAAGGCTCCTGTGGTGTCTAAGCAATCGAAAACAGTGACAACGGGCGAGACAGTGCAATT
GGAATTCCCGTCAGCCAAGTATCCTGAAACGGCCCAGCACATTAAGGAGGCCATTGCAGCAGGAAAGTCACCAGTATGCA
CCATAGACCGCGAAGGAGCAGACCATAATCGTGAGTTGTCATTGAAAGGTGTACCCACCAAGAAGGGCAAGGATCGCGAT
GAATGGCCTATGGCGATGTGTTCGGAAGGTGGAGAGGGTGCAGACATTAAGTACATAGCACCAAAGGATAATCGCGGAGC
TGGATCATGGGTAGGACACAAGTTGGACGAATATGCAGATGGAACGAAAGTGGAATTTATCGTAAAGTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| nucA/comI | Bacillus subtilis subsp. subtilis str. 168 |
62.602 |
95.349 |
0.597 |