Detailed information    

insolico Bioinformatically predicted

Overview


Name   abrB   Type   Regulator
Locus tag   XI92_RS12255 Genome accession   NZ_CP011349
Coordinates   2371078..2371356 (-) Length   92 a.a.
NCBI ID   WP_000799098.1    Uniprot ID   A0A9W5VHK7
Organism   Bacillus thuringiensis strain YC-10     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2331696..2379021 2371078..2371356 within 0


Gene organization within MGE regions


Location: 2331696..2379021
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  XI92_RS12000 (XI92_12000) - 2331696..2332793 (+) 1098 WP_000477499.1 tyrosine-type recombinase/integrase -
  XI92_RS12005 (XI92_12005) - 2332790..2334799 (+) 2010 WP_001028065.1 tyrosine-type recombinase/integrase -
  XI92_RS12010 (XI92_12010) - 2334792..2335196 (+) 405 WP_000247457.1 DUF6262 family protein -
  XI92_RS12015 (XI92_12015) - 2335265..2336056 (-) 792 WP_000349585.1 sulfotransferase family 2 domain-containing protein -
  XI92_RS12020 (XI92_12020) - 2336097..2336870 (-) 774 WP_000027993.1 sulfite exporter TauE/SafE family protein -
  XI92_RS12025 (XI92_12025) - 2336959..2337747 (-) 789 WP_000794364.1 sulfotransferase family 2 domain-containing protein -
  XI92_RS12030 (XI92_12030) - 2338044..2338352 (+) 309 WP_002133890.1 YolD-like family protein -
  XI92_RS12035 (XI92_12035) - 2338397..2339215 (-) 819 WP_000542507.1 GH25 family lysozyme -
  XI92_RS12040 (XI92_12040) - 2339215..2339421 (-) 207 WP_000159646.1 hypothetical protein -
  XI92_RS12045 (XI92_12045) - 2339424..2339705 (-) 282 WP_000215408.1 hypothetical protein -
  XI92_RS12050 (XI92_12050) - 2339742..2340119 (-) 378 WP_000354142.1 hypothetical protein -
  XI92_RS12055 (XI92_12055) - 2340136..2344530 (-) 4395 WP_015382161.1 phage tail spike protein -
  XI92_RS12060 (XI92_12060) - 2344527..2345996 (-) 1470 WP_015382160.1 distal tail protein Dit -
  XI92_RS12065 (XI92_12065) - 2346036..2351033 (-) 4998 WP_044157404.1 phage tail tape measure protein -
  XI92_RS12070 (XI92_12070) - 2351198..2351572 (-) 375 WP_015382157.1 hypothetical protein -
  XI92_RS12075 (XI92_12075) - 2351629..2352213 (-) 585 WP_001251821.1 major tail protein -
  XI92_RS12080 (XI92_12080) - 2352229..2352591 (-) 363 WP_001243517.1 DUF3168 domain-containing protein -
  XI92_RS12085 (XI92_12085) - 2352588..2353025 (-) 438 WP_000818832.1 HK97-gp10 family putative phage morphogenesis protein -
  XI92_RS12090 (XI92_12090) - 2353013..2353357 (-) 345 WP_001068032.1 phage head closure protein -
  XI92_RS12095 (XI92_12095) - 2353354..2353647 (-) 294 WP_000904085.1 head-tail connector protein -
  XI92_RS12100 (XI92_12100) - 2353682..2354854 (-) 1173 WP_001123701.1 phage major capsid protein -
  XI92_RS12105 (XI92_12105) - 2354892..2355590 (-) 699 WP_002134054.1 head maturation protease, ClpP-related -
  XI92_RS12110 (XI92_12110) - 2355881..2357074 (+) 1194 WP_000499523.1 IS110-like element ISBth13 family transposase -
  XI92_RS12115 (XI92_12115) - 2357169..2358389 (-) 1221 WP_000264107.1 phage portal protein -
  XI92_RS12120 (XI92_12120) - 2358403..2360118 (-) 1716 WP_001082759.1 terminase TerL endonuclease subunit -
  XI92_RS12125 (XI92_12125) - 2360128..2360649 (-) 522 WP_000113652.1 phage terminase small subunit P27 family -
  XI92_RS38540 (XI92_12130) - 2360748..2361161 (-) 414 WP_000924768.1 HNH endonuclease signature motif containing protein -
  XI92_RS37915 - 2361142..2361282 (-) 141 WP_228522936.1 hypothetical protein -
  XI92_RS12140 (XI92_12140) - 2361390..2361554 (-) 165 WP_001091354.1 helix-turn-helix domain-containing protein -
  XI92_RS12145 (XI92_12145) - 2361559..2361783 (-) 225 WP_000964495.1 hypothetical protein -
  XI92_RS12150 (XI92_12150) - 2361783..2362217 (-) 435 WP_000002735.1 hypothetical protein -
  XI92_RS12155 (XI92_12155) - 2362210..2362452 (-) 243 WP_000370222.1 hypothetical protein -
  XI92_RS12160 (XI92_12160) - 2363098..2363640 (-) 543 WP_016090301.1 site-specific integrase -
  XI92_RS12165 (XI92_12165) - 2363640..2364122 (-) 483 WP_000166188.1 ArpU family phage packaging/lysis transcriptional regulator -
  XI92_RS37330 (XI92_12170) - 2364150..2364320 (-) 171 WP_000677456.1 hypothetical protein -
  XI92_RS12175 (XI92_12175) - 2364449..2364835 (-) 387 WP_001226456.1 YopX family protein -
  XI92_RS12180 (XI92_12180) - 2364955..2365233 (-) 279 WP_000873130.1 hypothetical protein -
  XI92_RS12185 (XI92_12185) - 2365230..2365427 (-) 198 WP_000351065.1 hypothetical protein -
  XI92_RS37335 - 2365463..2365639 (-) 177 WP_000406974.1 hypothetical protein -
  XI92_RS12190 (XI92_12190) - 2365673..2366038 (-) 366 WP_002134061.1 hypothetical protein -
  XI92_RS37340 - 2366073..2366234 (-) 162 WP_002134063.1 hypothetical protein -
  XI92_RS12195 (XI92_12195) - 2366279..2366707 (-) 429 WP_000350118.1 hypothetical protein -
  XI92_RS37345 - 2366851..2367018 (-) 168 WP_000539656.1 hypothetical protein -
  XI92_RS12200 (XI92_12200) - 2367049..2367258 (-) 210 WP_000670920.1 hypothetical protein -
  XI92_RS12205 (XI92_12205) - 2367298..2367570 (-) 273 WP_001268380.1 hypothetical protein -
  XI92_RS12210 (XI92_12210) - 2367614..2367988 (-) 375 WP_228161154.1 hypothetical protein -
  XI92_RS12215 (XI92_12215) - 2368027..2368560 (-) 534 WP_001030635.1 hypothetical protein -
  XI92_RS12220 (XI92_12220) - 2368553..2368750 (-) 198 WP_000323893.1 hypothetical protein -
  XI92_RS12225 (XI92_12225) - 2368786..2369223 (-) 438 WP_002134064.1 hypothetical protein -
  XI92_RS12230 (XI92_12230) - 2369220..2369693 (-) 474 WP_001134294.1 hypothetical protein -
  XI92_RS12235 (XI92_12235) - 2369734..2370243 (-) 510 WP_001054607.1 dUTP diphosphatase -
  XI92_RS12240 (XI92_12240) - 2370263..2370514 (-) 252 WP_000109543.1 hypothetical protein -
  XI92_RS12245 (XI92_12245) - 2370540..2370707 (-) 168 WP_000717829.1 DUF3954 domain-containing protein -
  XI92_RS12250 (XI92_12250) - 2370726..2371085 (-) 360 WP_001125972.1 hypothetical protein -
  XI92_RS12255 (XI92_12255) abrB 2371078..2371356 (-) 279 WP_000799098.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  XI92_RS12260 (XI92_12260) - 2371373..2371567 (-) 195 WP_000337984.1 hypothetical protein -
  XI92_RS12265 (XI92_12265) - 2371570..2372433 (-) 864 WP_001148230.1 ATP-binding protein -
  XI92_RS12270 (XI92_12270) - 2372381..2373121 (-) 741 WP_000190244.1 DnaD domain protein -
  XI92_RS37350 (XI92_12275) - 2373126..2373302 (-) 177 WP_001084331.1 hypothetical protein -
  XI92_RS12280 (XI92_12280) - 2373332..2373499 (-) 168 WP_000969632.1 hypothetical protein -
  XI92_RS12285 (XI92_12285) - 2373496..2373846 (-) 351 WP_001246222.1 helix-turn-helix domain-containing protein -
  XI92_RS12290 (XI92_12290) - 2373843..2374085 (-) 243 WP_000022043.1 helix-turn-helix transcriptional regulator -
  XI92_RS12295 (XI92_12295) - 2374307..2374660 (+) 354 WP_000172107.1 helix-turn-helix transcriptional regulator -
  XI92_RS38360 - 2374680..2374802 (-) 123 WP_000237930.1 hypothetical protein -
  XI92_RS12300 (XI92_12300) - 2375174..2376313 (-) 1140 WP_000838797.1 AimR family lysis-lysogeny pheromone receptor -
  XI92_RS12305 (XI92_12305) - 2376875..2377738 (+) 864 WP_000703672.1 hypothetical protein -
  XI92_RS12310 (XI92_12310) - 2377897..2379021 (+) 1125 WP_000679465.1 tyrosine-type recombinase/integrase -

Sequence


Protein


Download         Length: 92 a.a.        Molecular weight: 9941.45 Da        Isoelectric Point: 5.1782

>NTDB_id=144987 XI92_RS12255 WP_000799098.1 2371078..2371356(-) (abrB) [Bacillus thuringiensis strain YC-10]
MKNTGVSRKVDELGRVVIPVELRRNLGIVEGTALGFHVEGENIVLKKQDKSCFVTGEVSESNIELLEGRMFLSKEGASEL
LGAIEKSGIVNA

Nucleotide


Download         Length: 279 bp        

>NTDB_id=144987 XI92_RS12255 WP_000799098.1 2371078..2371356(-) (abrB) [Bacillus thuringiensis strain YC-10]
ATGAAAAACACAGGTGTTTCAAGAAAAGTGGACGAGCTAGGGCGTGTGGTAATTCCAGTAGAGTTACGCAGAAATTTAGG
AATTGTTGAAGGTACAGCATTAGGATTTCATGTTGAAGGGGAAAACATCGTTTTAAAAAAACAGGATAAGTCATGCTTTG
TAACGGGTGAAGTTTCTGAATCAAACATAGAGTTGCTAGAGGGTCGGATGTTTTTAAGTAAGGAAGGTGCAAGTGAGTTG
CTGGGCGCTATTGAGAAGAGTGGGATTGTAAATGCCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

56.322

94.565

0.533


Multiple sequence alignment