Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   AAV30_RS04605 Genome accession   NZ_CP011347
Coordinates   917113..917253 (+) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain YJ11-1-4     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 912113..922253
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAV30_RS04580 (AAV30_04580) - 912416..912814 (+) 399 WP_003152031.1 YueI family protein -
  AAV30_RS04585 (AAV30_04585) - 912911..913462 (+) 552 WP_003152033.1 cysteine hydrolase family protein -
  AAV30_RS04590 (AAV30_04590) - 913480..914946 (+) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  AAV30_RS04595 (AAV30_04595) - 915076..916299 (+) 1224 WP_032876792.1 EAL and HDOD domain-containing protein -
  AAV30_RS04600 (AAV30_04600) - 916306..916647 (-) 342 WP_038459666.1 hypothetical protein -
  AAV30_RS04605 (AAV30_04605) degQ 917113..917253 (+) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  AAV30_RS04610 (AAV30_04610) - 917404..918315 (+) 912 WP_079891857.1 polyprenyl synthetase family protein -
  AAV30_RS04615 (AAV30_04615) comX 918315..918479 (+) 165 WP_007613432.1 competence pheromone ComX -
  AAV30_RS04620 (AAV30_04620) comP 918491..920782 (+) 2292 WP_038459663.1 histidine kinase Regulator
  AAV30_RS04625 (AAV30_04625) comA 920863..921507 (+) 645 WP_003152052.1 response regulator transcription factor Regulator
  AAV30_RS04630 (AAV30_04630) - 921529..921912 (+) 384 WP_007613430.1 hotdog fold thioesterase -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=144911 AAV30_RS04605 WP_003152043.1 917113..917253(+) (degQ) [Bacillus velezensis strain YJ11-1-4]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=144911 AAV30_RS04605 WP_003152043.1 917113..917253(+) (degQ) [Bacillus velezensis strain YJ11-1-4]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891


Multiple sequence alignment