Detailed information
Bioinformatically predicted
Overview
| Name | degQ | Type | Regulator |
| Locus tag | AAV30_RS04605 | Genome accession | NZ_CP011347 |
| Coordinates | 917113..917253 (+) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus velezensis strain YJ11-1-4 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 912113..922253
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AAV30_RS04580 (AAV30_04580) | - | 912416..912814 (+) | 399 | WP_003152031.1 | YueI family protein | - |
| AAV30_RS04585 (AAV30_04585) | - | 912911..913462 (+) | 552 | WP_003152033.1 | cysteine hydrolase family protein | - |
| AAV30_RS04590 (AAV30_04590) | - | 913480..914946 (+) | 1467 | WP_014418767.1 | nicotinate phosphoribosyltransferase | - |
| AAV30_RS04595 (AAV30_04595) | - | 915076..916299 (+) | 1224 | WP_032876792.1 | EAL and HDOD domain-containing protein | - |
| AAV30_RS04600 (AAV30_04600) | - | 916306..916647 (-) | 342 | WP_038459666.1 | hypothetical protein | - |
| AAV30_RS04605 (AAV30_04605) | degQ | 917113..917253 (+) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| AAV30_RS04610 (AAV30_04610) | - | 917404..918315 (+) | 912 | WP_079891857.1 | polyprenyl synthetase family protein | - |
| AAV30_RS04615 (AAV30_04615) | comX | 918315..918479 (+) | 165 | WP_007613432.1 | competence pheromone ComX | - |
| AAV30_RS04620 (AAV30_04620) | comP | 918491..920782 (+) | 2292 | WP_038459663.1 | histidine kinase | Regulator |
| AAV30_RS04625 (AAV30_04625) | comA | 920863..921507 (+) | 645 | WP_003152052.1 | response regulator transcription factor | Regulator |
| AAV30_RS04630 (AAV30_04630) | - | 921529..921912 (+) | 384 | WP_007613430.1 | hotdog fold thioesterase | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=144911 AAV30_RS04605 WP_003152043.1 917113..917253(+) (degQ) [Bacillus velezensis strain YJ11-1-4]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=144911 AAV30_RS04605 WP_003152043.1 917113..917253(+) (degQ) [Bacillus velezensis strain YJ11-1-4]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |