Detailed information NTG0143602

Bioinformatically predicted

Overview

• Name: comX
• Type: Regulator
• Locus tag: SMQ301_RS00925
• Genome accession: NZ_CP011217
• Coordinates: 155714..156211 (+)
• Length: 165 a.a.
• NCBI ID: WP_002949220.1
• Uniprot ID: A0A0M4HKA9
• Organism: Streptococcus thermophilus strain SMQ-301
• Function: activation of late competence genes (predicted from homology) Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
IS/Tn	154466..154960	155714..156211	flank	754

Gene organization within MGE regions

Location: 154466..156211

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SMQ301_RS00920 (SMQ301_0136)	-	154496..154960 (-)	465	Protein_122	transposase family protein	-
SMQ301_RS10510	-	155318..155422 (+)	105	Protein_123	IS200/IS605 family transposase	-
SMQ301_RS00925 (SMQ301_0137)	comX	155714..156211 (+)	498	WP_002949220.1	sigma factor	Regulator

Sequence

Protein

• Length: 165 a.a.
• Molecular weight: 20160.12 Da
• Isoelectric Point: 5.2073

>NTDB_id=143602 SMQ301_RS00925 WP_002949220.1 155714..156211(+) (comX) [Streptococcus thermophilus strain SMQ-301]
MEQEVFVKAYEKVRPIVLKAFRQYFIQLWDQADMEQEAMMTLYQLLKKFPDLEKDDDKLRRYFKTKFRNRLNDEVRRQES
VKRQANRQCYVEISDIAFCIPNKELDMVDRLAYDEQLNAFREQLSSEDSLKLDRLLGGECFRGRKKMIRELRFWMVDFDP
CNEED

Nucleotide

• Length: 498 bp

>NTDB_id=143602 SMQ301_RS00925 WP_002949220.1 155714..156211(+) (comX) [Streptococcus thermophilus strain SMQ-301]
ATGGAACAAGAAGTTTTTGTTAAGGCATATGAAAAGGTAAGGCCAATTGTACTTAAGGCTTTTAGGCAATACTTTATTCA
GCTTTGGGATCAAGCTGACATGGAGCAAGAGGCGATGATGACTTTGTATCAGCTTTTAAAAAAGTTTCCTGATTTAGAGA
AAGATGATGATAAGTTACGTCGTTACTTTAAAACTAAGTTTAGGAATCGACTTAATGATGAAGTGAGGCGGCAGGAGTCA
GTAAAACGTCAAGCTAATAGACAGTGCTATGTTGAAATTTCAGATATTGCCTTTTGTATTCCCAATAAGGAGCTAGATAT
GGTTGATAGACTTGCTTATGATGAACAGCTTAATGCTTTTCGTGAGCAGTTATCATCGGAAGATTCTCTTAAGTTGGATC
GATTGTTGGGTGGTGAATGCTTTAGGGGAAGGAAAAAGATGATACGAGAGTTAAGATTTTGGATGGTTGACTTTGATCCA
TGTAATGAAGAAGACTGA

Domains

Predicted by InterproScan.

• Sigma-70 region 2 (Sigma70_r2) (10-79)

3D structure

• AlphaFold DB: A0A0M4HKA9

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comX	Streptococcus thermophilus LMD-9	100	100	1
comX	Streptococcus thermophilus LMG 18311	100	100	1
comX/sigX	Streptococcus salivarius strain HSISS4	89.091	100	0.891
comX	Streptococcus salivarius SK126	88.485	100	0.885
comX	Streptococcus sobrinus strain NIDR 6715-7	41.975	98.182	0.412
comR/comR2	Streptococcus gordonii str. Challis substr. CH1	42.581	93.939	0.4
comR/comR1	Streptococcus gordonii str. Challis substr. CH1	42.581	93.939	0.4
comX/sigX	Streptococcus infantarius subsp. infantarius ATCC BAA-102	41.667	94.545	0.394
comX/sigX	Streptococcus mutans UA159	41.026	94.545	0.388
comX/sigX/comX1/sigX1	Streptococcus pyogenes MGAS8232	42.667	90.909	0.388
comX/sigX/comX2/sigX2	Streptococcus pyogenes JRS4	42.667	90.909	0.388
comX/sigX/comX1/sigX1	Streptococcus pyogenes JRS4	42.667	90.909	0.388
comX/sigX/comX2/sigX2	Streptococcus pyogenes MGAS8232	42.667	90.909	0.388
comX/sigX/comX1/sigX1	Streptococcus pyogenes MGAS315	42	90.909	0.382
comX/sigX/comX2/sigX2	Streptococcus pyogenes MGAS315	42	90.909	0.382
comX/sigX	Streptococcus suis D9	40.523	92.727	0.376
comX/sigX	Streptococcus suis isolate S10	40.523	92.727	0.376
comX/sigX	Streptococcus suis P1/7	40.523	92.727	0.376