Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | WR52_RS12450 | Genome accession | NZ_CP011155 |
| Coordinates | 2493758..2494036 (+) | Length | 92 a.a. |
| NCBI ID | WP_063536443.1 | Uniprot ID | - |
| Organism | Bacillus cereus strain HN001 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2483756..2526717 | 2493758..2494036 | within | 0 |
Gene organization within MGE regions
Location: 2483756..2526717
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| WR52_RS12390 (WR52_12690) | tenA | 2483756..2484445 (+) | 690 | WP_000144509.1 | thiaminase II | - |
| WR52_RS12395 (WR52_12695) | - | 2484843..2485106 (+) | 264 | WP_002082716.1 | DUF3937 domain-containing protein | - |
| WR52_RS12400 (WR52_12700) | - | 2485650..2485943 (+) | 294 | WP_080470706.1 | heterocycloanthracin/sonorensin family bacteriocin | - |
| WR52_RS32235 | - | 2486089..2486223 (+) | 135 | Protein_2420 | site-specific integrase | - |
| WR52_RS12405 (WR52_12705) | - | 2486433..2486918 (+) | 486 | WP_002178127.1 | hypothetical protein | - |
| WR52_RS12410 (WR52_12710) | - | 2487230..2487931 (+) | 702 | WP_063536437.1 | DUF3962 domain-containing protein | - |
| WR52_RS12415 (WR52_12715) | - | 2487970..2489079 (-) | 1110 | WP_063536438.1 | tyrosine-type recombinase/integrase | - |
| WR52_RS12420 (WR52_12720) | - | 2489685..2490893 (+) | 1209 | WP_063536439.1 | AimR family lysis-lysogeny pheromone receptor | - |
| WR52_RS32585 | - | 2490920..2491075 (+) | 156 | WP_000790840.1 | hypothetical protein | - |
| WR52_RS12430 (WR52_12730) | - | 2491339..2491689 (-) | 351 | WP_000367267.1 | helix-turn-helix transcriptional regulator | - |
| WR52_RS12435 (WR52_12735) | - | 2491876..2492100 (+) | 225 | WP_063536440.1 | helix-turn-helix transcriptional regulator | - |
| WR52_RS12440 (WR52_12740) | - | 2492141..2492407 (+) | 267 | WP_063536441.1 | helix-turn-helix domain-containing protein | - |
| WR52_RS32590 (WR52_12745) | - | 2492407..2492562 (+) | 156 | WP_080470707.1 | hypothetical protein | - |
| WR52_RS12445 (WR52_12755) | - | 2492783..2493754 (+) | 972 | WP_063536442.1 | DnaD domain protein | - |
| WR52_RS12450 (WR52_12760) | abrB | 2493758..2494036 (+) | 279 | WP_063536443.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| WR52_RS12455 (WR52_12765) | - | 2494029..2494388 (+) | 360 | WP_063536444.1 | hypothetical protein | - |
| WR52_RS30650 (WR52_12770) | - | 2494408..2494575 (+) | 168 | WP_080470708.1 | DUF3954 domain-containing protein | - |
| WR52_RS12460 (WR52_12775) | - | 2494601..2494852 (+) | 252 | WP_063536445.1 | hypothetical protein | - |
| WR52_RS12465 (WR52_12780) | - | 2494872..2495381 (+) | 510 | WP_063536446.1 | dUTP diphosphatase | - |
| WR52_RS12470 (WR52_12785) | - | 2495527..2496303 (-) | 777 | WP_063536447.1 | sulfotransferase family 2 domain-containing protein | - |
| WR52_RS12475 (WR52_12790) | - | 2496573..2497294 (-) | 722 | Protein_2437 | glycosyltransferase family 2 protein | - |
| WR52_RS12480 (WR52_12795) | - | 2498230..2498550 (+) | 321 | WP_063536448.1 | hypothetical protein | - |
| WR52_RS12485 (WR52_12800) | - | 2499896..2500096 (-) | 201 | WP_063536449.1 | spore germination protein | - |
| WR52_RS32595 (WR52_12810) | - | 2501280..2501450 (+) | 171 | WP_080470710.1 | hypothetical protein | - |
| WR52_RS12490 (WR52_12815) | - | 2501478..2501960 (+) | 483 | WP_063536450.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| WR52_RS12495 (WR52_12820) | - | 2501960..2502502 (+) | 543 | WP_063536451.1 | site-specific integrase | - |
| WR52_RS33605 (WR52_12825) | - | 2502747..2502926 (-) | 180 | WP_063536452.1 | hypothetical protein | - |
| WR52_RS12505 (WR52_12830) | - | 2503499..2504914 (+) | 1416 | WP_063538352.1 | amino acid permease | - |
| WR52_RS12510 (WR52_12835) | - | 2505020..2505961 (-) | 942 | WP_154818484.1 | IS3 family transposase | - |
| WR52_RS12515 (WR52_12840) | - | 2505883..2506191 (-) | 309 | WP_000516502.1 | helix-turn-helix domain-containing protein | - |
| WR52_RS12520 (WR52_12845) | - | 2506576..2507313 (+) | 738 | WP_063536454.1 | hypothetical protein | - |
| WR52_RS12525 (WR52_12850) | - | 2507672..2508529 (+) | 858 | WP_063536455.1 | hypothetical protein | - |
| WR52_RS12530 (WR52_12855) | - | 2508740..2509033 (+) | 294 | WP_063536456.1 | Rho termination factor N-terminal domain-containing protein | - |
| WR52_RS12535 (WR52_12860) | - | 2509030..2509422 (+) | 393 | WP_063536457.1 | HNH endonuclease signature motif containing protein | - |
| WR52_RS12540 (WR52_12865) | - | 2509506..2509931 (+) | 426 | WP_063538354.1 | P27 family phage terminase small subunit | - |
| WR52_RS12545 (WR52_12870) | - | 2509928..2511652 (+) | 1725 | WP_063536458.1 | terminase TerL endonuclease subunit | - |
| WR52_RS12550 (WR52_12875) | - | 2511668..2512852 (+) | 1185 | WP_063536459.1 | phage portal protein | - |
| WR52_RS12555 (WR52_12880) | - | 2512842..2513423 (+) | 582 | WP_063536460.1 | HK97 family phage prohead protease | - |
| WR52_RS12560 (WR52_12885) | - | 2513425..2514735 (+) | 1311 | WP_063536461.1 | phage major capsid protein | - |
| WR52_RS12565 (WR52_12890) | - | 2514737..2514997 (+) | 261 | WP_063536462.1 | head-tail connector protein | - |
| WR52_RS12570 (WR52_12895) | - | 2514978..2515307 (+) | 330 | WP_063536463.1 | head-tail adaptor protein | - |
| WR52_RS12575 (WR52_12900) | - | 2515297..2515626 (+) | 330 | WP_063536464.1 | hypothetical protein | - |
| WR52_RS12580 (WR52_12905) | - | 2515626..2516003 (+) | 378 | WP_063536465.1 | HK97 gp10 family phage protein | - |
| WR52_RS12585 (WR52_12910) | - | 2516015..2516650 (+) | 636 | WP_000215488.1 | major tail protein | - |
| WR52_RS12590 (WR52_12915) | - | 2516662..2517048 (+) | 387 | WP_063536466.1 | hypothetical protein | - |
| WR52_RS12595 (WR52_12920) | - | 2517292..2520816 (+) | 3525 | WP_063536467.1 | phage tail tape measure protein | - |
| WR52_RS12600 (WR52_12925) | - | 2520817..2521500 (+) | 684 | WP_063536468.1 | phage tail domain-containing protein | - |
| WR52_RS12605 (WR52_12930) | - | 2521497..2523839 (+) | 2343 | WP_063536469.1 | phage tail spike protein | - |
| WR52_RS12610 (WR52_12935) | - | 2523854..2525029 (+) | 1176 | WP_063536470.1 | BppU family phage baseplate upper protein | - |
| WR52_RS12615 (WR52_12940) | - | 2525183..2525407 (+) | 225 | WP_000390479.1 | hypothetical protein | - |
| WR52_RS12620 (WR52_12945) | - | 2525483..2525908 (+) | 426 | WP_063536471.1 | phage holin family protein | - |
| WR52_RS12625 (WR52_12950) | - | 2525908..2526717 (+) | 810 | WP_063536472.1 | GH25 family lysozyme | - |
Sequence
Protein
Download Length: 92 a.a. Molecular weight: 10139.78 Da Isoelectric Point: 5.1546
>NTDB_id=142990 WR52_RS12450 WP_063536443.1 2493758..2494036(+) (abrB) [Bacillus cereus strain HN001]
MKNTGVARKVDELGRVVIPVELRRTLGIVEGTALDFYVDGENIVLRKYEKSCFVTGEVSETNIELLGGRMFLSKEGAIEL
LDLIQKSGMAHA
MKNTGVARKVDELGRVVIPVELRRTLGIVEGTALDFYVDGENIVLRKYEKSCFVTGEVSETNIELLGGRMFLSKEGAIEL
LDLIQKSGMAHA
Nucleotide
Download Length: 279 bp
>NTDB_id=142990 WR52_RS12450 WP_063536443.1 2493758..2494036(+) (abrB) [Bacillus cereus strain HN001]
ATGAAAAACACAGGCGTTGCAAGAAAAGTGGACGAGCTAGGTCGTGTAGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
GATTGTCGAAGGTACGGCACTAGATTTTTATGTCGATGGGGAAAACATTGTTCTAAGAAAATATGAAAAGTCATGCTTTG
TAACGGGTGAAGTTTCCGAAACCAACATAGAGTTGCTAGGTGGCCGAATGTTTTTAAGCAAGGAAGGGGCAATTGAATTA
CTGGATCTTATTCAGAAGAGTGGGATGGCACATGCCTAA
ATGAAAAACACAGGCGTTGCAAGAAAAGTGGACGAGCTAGGTCGTGTAGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
GATTGTCGAAGGTACGGCACTAGATTTTTATGTCGATGGGGAAAACATTGTTCTAAGAAAATATGAAAAGTCATGCTTTG
TAACGGGTGAAGTTTCCGAAACCAACATAGAGTTGCTAGGTGGCCGAATGTTTTTAAGCAAGGAAGGGGCAATTGAATTA
CTGGATCTTATTCAGAAGAGTGGGATGGCACATGCCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
62.069 |
94.565 |
0.587 |