Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | WR51_RS13055 | Genome accession | NZ_CP011153 |
| Coordinates | 2648659..2648937 (+) | Length | 92 a.a. |
| NCBI ID | WP_063547383.1 | Uniprot ID | - |
| Organism | Bacillus cereus strain CMCC P0011 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2625399..2679762 | 2648659..2648937 | within | 0 |
Gene organization within MGE regions
Location: 2625399..2679762
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| WR51_RS12925 (WR51_13275) | - | 2625399..2626169 (+) | 771 | WP_063547371.1 | ABC transporter ATP-binding protein | - |
| WR51_RS12930 (WR51_13280) | - | 2626144..2628075 (+) | 1932 | WP_000144179.1 | ABC transporter permease | - |
| WR51_RS12935 (WR51_13285) | - | 2628143..2628811 (+) | 669 | WP_063547372.1 | lipoprotein BA_5634 family protein | - |
| WR51_RS12940 (WR51_13290) | - | 2628888..2629229 (-) | 342 | WP_048657145.1 | DUF3914 domain-containing protein | - |
| WR51_RS12945 (WR51_13295) | - | 2629508..2630749 (+) | 1242 | WP_000517062.1 | esterase/lipase family protein | - |
| WR51_RS12950 (WR51_13300) | - | 2630837..2631862 (+) | 1026 | WP_063547373.1 | homoserine dehydrogenase | - |
| WR51_RS12955 (WR51_13305) | - | 2631952..2633400 (+) | 1449 | WP_000471611.1 | PLP-dependent aminotransferase family protein | - |
| WR51_RS12960 (WR51_13310) | - | 2633405..2634319 (+) | 915 | WP_063549318.1 | D-alanine--D-alanine ligase | - |
| WR51_RS12965 (WR51_13315) | tenA | 2634626..2635315 (+) | 690 | WP_000144507.1 | thiaminase II | - |
| WR51_RS12970 (WR51_13320) | - | 2635713..2635976 (+) | 264 | WP_002082716.1 | DUF3937 domain-containing protein | - |
| WR51_RS12975 (WR51_13325) | - | 2636525..2636848 (+) | 324 | WP_063547374.1 | heterocycloanthracin/sonorensin family bacteriocin | - |
| WR51_RS32190 | - | 2636983..2637134 (+) | 152 | Protein_2538 | site-specific integrase | - |
| WR51_RS12980 (WR51_13330) | - | 2637344..2637829 (+) | 486 | WP_002041181.1 | hypothetical protein | - |
| WR51_RS12985 (WR51_13335) | - | 2638141..2638812 (+) | 672 | WP_000736204.1 | pPIWI_RE module domain-containing protein | - |
| WR51_RS12990 (WR51_13340) | - | 2638881..2639990 (-) | 1110 | WP_063547375.1 | tyrosine-type recombinase/integrase | - |
| WR51_RS12995 (WR51_13345) | - | 2640222..2640695 (+) | 474 | WP_063547376.1 | hypothetical protein | - |
| WR51_RS13000 (WR51_13350) | - | 2640929..2641390 (+) | 462 | WP_000734558.1 | hypothetical protein | - |
| WR51_RS13005 (WR51_13355) | - | 2641650..2642621 (+) | 972 | WP_063547377.1 | FRG domain-containing protein | - |
| WR51_RS13010 (WR51_13360) | - | 2643079..2644176 (+) | 1098 | WP_063547378.1 | AimR family lysis-lysogeny pheromone receptor | - |
| WR51_RS32555 | - | 2644189..2644338 (+) | 150 | WP_080469931.1 | hypothetical protein | - |
| WR51_RS33195 | - | 2644457..2644585 (+) | 129 | WP_255288311.1 | hypothetical protein | - |
| WR51_RS13015 (WR51_13365) | - | 2644601..2644969 (-) | 369 | WP_063547379.1 | helix-turn-helix domain-containing protein | - |
| WR51_RS13020 (WR51_13370) | - | 2645213..2645422 (+) | 210 | WP_063547380.1 | helix-turn-helix transcriptional regulator | - |
| WR51_RS13025 (WR51_13375) | - | 2645492..2645758 (+) | 267 | WP_000522020.1 | helix-turn-helix domain-containing protein | - |
| WR51_RS32560 (WR51_13380) | - | 2645758..2645922 (+) | 165 | WP_080469807.1 | hypothetical protein | - |
| WR51_RS32565 (WR51_13385) | - | 2645952..2646128 (+) | 177 | WP_080469808.1 | hypothetical protein | - |
| WR51_RS13030 (WR51_13390) | - | 2646133..2646876 (+) | 744 | WP_063547381.1 | DnaD domain protein | - |
| WR51_RS13035 (WR51_13395) | - | 2646845..2647648 (+) | 804 | WP_063547382.1 | ATP-binding protein | - |
| WR51_RS13040 (WR51_13400) | - | 2647663..2647857 (+) | 195 | WP_000332458.1 | hypothetical protein | - |
| WR51_RS13045 (WR51_13405) | - | 2647874..2648284 (+) | 411 | WP_000792379.1 | hypothetical protein | - |
| WR51_RS13050 (WR51_13410) | - | 2648317..2648571 (-) | 255 | WP_000312979.1 | hypothetical protein | - |
| WR51_RS13055 (WR51_13415) | abrB | 2648659..2648937 (+) | 279 | WP_063547383.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| WR51_RS13060 (WR51_13420) | - | 2648930..2649289 (+) | 360 | WP_063547384.1 | hypothetical protein | - |
| WR51_RS30880 (WR51_13425) | - | 2649308..2649475 (+) | 168 | WP_000717826.1 | DUF3954 domain-containing protein | - |
| WR51_RS13065 (WR51_13430) | - | 2649501..2649752 (+) | 252 | WP_063547385.1 | hypothetical protein | - |
| WR51_RS13070 (WR51_13435) | - | 2649772..2650227 (+) | 456 | WP_063547386.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| WR51_RS13075 (WR51_13440) | - | 2650389..2650643 (+) | 255 | WP_050822240.1 | hypothetical protein | - |
| WR51_RS13080 (WR51_13445) | - | 2650754..2651353 (-) | 600 | WP_063547387.1 | undecaprenyl-diphosphatase | - |
| WR51_RS13085 (WR51_13450) | - | 2651893..2653275 (-) | 1383 | WP_063547388.1 | BclA C-terminal domain-containing protein | - |
| WR51_RS13090 (WR51_13455) | - | 2653559..2653879 (+) | 321 | WP_063547389.1 | hypothetical protein | - |
| WR51_RS13095 (WR51_13460) | - | 2653914..2654159 (+) | 246 | WP_063547390.1 | hypothetical protein | - |
| WR51_RS13100 (WR51_13465) | - | 2654282..2654557 (+) | 276 | WP_063547391.1 | hypothetical protein | - |
| WR51_RS13105 (WR51_13470) | - | 2654680..2655006 (+) | 327 | WP_063547392.1 | hypothetical protein | - |
| WR51_RS30885 (WR51_13475) | - | 2655055..2655153 (+) | 99 | WP_080469932.1 | DUF3983 domain-containing protein | - |
| WR51_RS13110 (WR51_13480) | - | 2655174..2655362 (+) | 189 | WP_063547393.1 | hypothetical protein | - |
| WR51_RS32570 (WR51_13485) | - | 2655461..2655631 (+) | 171 | WP_033695145.1 | hypothetical protein | - |
| WR51_RS13115 (WR51_13490) | - | 2655659..2656141 (+) | 483 | WP_063547394.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| WR51_RS13120 (WR51_13495) | - | 2656141..2656683 (+) | 543 | WP_053564381.1 | site-specific integrase | - |
| WR51_RS13125 (WR51_13500) | - | 2656898..2657848 (+) | 951 | WP_061139243.1 | nucleoside hydrolase | - |
| WR51_RS13130 (WR51_13505) | - | 2658680..2658892 (+) | 213 | WP_063547395.1 | hypothetical protein | - |
| WR51_RS13135 (WR51_13510) | - | 2658889..2659110 (+) | 222 | WP_230387345.1 | hypothetical protein | - |
| WR51_RS13140 (WR51_13515) | - | 2659251..2659577 (+) | 327 | WP_063547396.1 | HNH endonuclease | - |
| WR51_RS13145 (WR51_13520) | - | 2659634..2659888 (+) | 255 | WP_404222201.1 | hypothetical protein | - |
| WR51_RS13150 (WR51_13525) | - | 2660198..2660695 (+) | 498 | WP_063547398.1 | P27 family phage terminase small subunit | - |
| WR51_RS13155 (WR51_13530) | - | 2660670..2662346 (+) | 1677 | WP_063547399.1 | terminase TerL endonuclease subunit | - |
| WR51_RS13160 (WR51_13535) | - | 2662363..2663607 (+) | 1245 | WP_063547400.1 | phage portal protein | - |
| WR51_RS13165 (WR51_13540) | - | 2663624..2664256 (+) | 633 | WP_003272656.1 | head maturation protease, ClpP-related | - |
| WR51_RS13170 (WR51_13545) | - | 2664270..2665394 (+) | 1125 | WP_000588590.1 | phage major capsid protein | - |
| WR51_RS13175 (WR51_13550) | - | 2665408..2665731 (+) | 324 | WP_001282872.1 | hypothetical protein | - |
| WR51_RS13180 (WR51_13555) | - | 2665721..2666077 (+) | 357 | WP_000963758.1 | hypothetical protein | - |
| WR51_RS13185 (WR51_13560) | - | 2666064..2666444 (+) | 381 | WP_016512759.1 | hypothetical protein | - |
| WR51_RS13190 (WR51_13565) | - | 2666434..2666844 (+) | 411 | WP_001111193.1 | hypothetical protein | - |
| WR51_RS13195 (WR51_13570) | - | 2666846..2667415 (+) | 570 | WP_001145608.1 | hypothetical protein | - |
| WR51_RS13200 (WR51_13575) | - | 2667477..2667827 (+) | 351 | WP_000159510.1 | hypothetical protein | - |
| WR51_RS13205 (WR51_13580) | - | 2668010..2671840 (+) | 3831 | WP_063547401.1 | phage tail tape measure protein | - |
| WR51_RS13210 (WR51_13585) | - | 2671833..2672519 (+) | 687 | WP_000227695.1 | hypothetical protein | - |
| WR51_RS13215 (WR51_13590) | - | 2672516..2675245 (+) | 2730 | WP_063547402.1 | phage tail spike protein | - |
| WR51_RS13220 (WR51_13595) | - | 2675284..2675520 (+) | 237 | WP_000387825.1 | hemolysin XhlA family protein | - |
| WR51_RS13225 (WR51_13600) | - | 2675520..2675759 (+) | 240 | WP_000461715.1 | hypothetical protein | - |
| WR51_RS13230 (WR51_13605) | - | 2675756..2676820 (+) | 1065 | WP_063547403.1 | N-acetylmuramoyl-L-alanine amidase | - |
| WR51_RS13235 (WR51_13610) | - | 2676862..2677770 (+) | 909 | WP_063553416.1 | exosporium leader peptide-containing protein | - |
| WR51_RS13240 (WR51_13615) | - | 2678035..2678334 (-) | 300 | WP_000998176.1 | contact-dependent growth inhibition system immunity protein | - |
| WR51_RS13245 (WR51_13620) | - | 2678353..2679762 (-) | 1410 | WP_063547405.1 | WXG100 family type VII secretion target | - |
Sequence
Protein
Download Length: 92 a.a. Molecular weight: 10139.78 Da Isoelectric Point: 5.1546
>NTDB_id=142939 WR51_RS13055 WP_063547383.1 2648659..2648937(+) (abrB) [Bacillus cereus strain CMCC P0011]
MKNTGVARKVDELGRVVIPVELRRTLGIVEGTALDFHVDGENIVLRKYEKSCFVTGEVSETNIELLGGRMFLSKEGAIEL
LDLIQKSGMAYA
MKNTGVARKVDELGRVVIPVELRRTLGIVEGTALDFHVDGENIVLRKYEKSCFVTGEVSETNIELLGGRMFLSKEGAIEL
LDLIQKSGMAYA
Nucleotide
Download Length: 279 bp
>NTDB_id=142939 WR51_RS13055 WP_063547383.1 2648659..2648937(+) (abrB) [Bacillus cereus strain CMCC P0011]
ATGAAAAATACAGGTGTTGCAAGAAAAGTGGACGAGCTAGGTCGTGTAGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
GATTGTCGAAGGTACGGCACTAGATTTTCATGTCGATGGGGAAAACATTGTTCTAAGAAAATATGAAAAGTCATGCTTTG
TAACGGGTGAAGTTTCTGAAACCAACATAGAGTTGCTAGGTGGCCGAATGTTTTTAAGCAAGGAAGGGGCAATTGAATTA
CTGGATCTTATTCAGAAGAGTGGGATGGCATATGCCTAA
ATGAAAAATACAGGTGTTGCAAGAAAAGTGGACGAGCTAGGTCGTGTAGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
GATTGTCGAAGGTACGGCACTAGATTTTCATGTCGATGGGGAAAACATTGTTCTAAGAAAATATGAAAAGTCATGCTTTG
TAACGGGTGAAGTTTCTGAAACCAACATAGAGTTGCTAGGTGGCCGAATGTTTTTAAGCAAGGAAGGGGCAATTGAATTA
CTGGATCTTATTCAGAAGAGTGGGATGGCATATGCCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
60.92 |
94.565 |
0.576 |